DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and eor-1

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_500645.1 Gene:eor-1 WormBaseID:WBGene00001324 Length:909 Species:Caenorhabditis elegans

Alignment Length:174 Identity:56/175 (32%)
Similarity:76/175 (43%) Gaps:13/175 (7%)


  Fly   234 CPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDR 298
            |.||..|.....||..|......:.:....||||.:.|....:|.:||.| |:..||:.|:.|. 
 Worm   511 CGECAWKGRTRSQLFAHERMHSVLDDRSLHCEECGRGFQQHSTLDHHVAS-HNDPRPYICEDCG- 573

  Fly   299 RFILRT--QLLSHLRTHTGEAKPRIFECQ--RCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSK 359
             |..:|  .|..|.|.|||:.    |.|.  .|..|...||.|..|:|:|  ...|...|..|.:
 Worm   574 -FATKTADHLSLHRRQHTGDN----FSCHIAGCDYSSTKKSQLAAHLRTH--MAVRAHLCKICGR 631

  Fly   360 AFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403
            .|..:.||..|..:|..||||.|:.|:........|..|:::.|
 Worm   632 GFIEKSHLVRHERIHLEEKPFKCDQCEYASSRRDKLKEHIIKHH 675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/21 (33%)
C2H2 Zn finger 264..285 CDD:275368 9/21 (43%)
C2H2 Zn finger 293..313 CDD:275368 7/22 (32%)
zf-C2H2_8 305..373 CDD:292531 23/70 (33%)
C2H2 Zn finger 324..344 CDD:275368 8/22 (36%)
C2H2 Zn finger 354..374 CDD:275368 6/20 (30%)
zf-H2C2_2 366..389 CDD:290200 10/23 (43%)
C2H2 Zn finger 382..403 CDD:275368 4/21 (19%)
eor-1NP_500645.1 BTB 32..134 CDD:279045
BTB 43..137 CDD:197585
BACK 142..242 CDD:197943
C2H2 Zn finger 455..475 CDD:275368
zf-C2H2_8 <481..527 CDD:292531 6/16 (38%)
C2H2 Zn finger 483..503 CDD:275368
C2H2 Zn finger 511..531 CDD:275368 7/20 (35%)
C2H2 Zn finger 541..561 CDD:275368 9/21 (43%)
C2H2 Zn finger 569..589 CDD:275368 7/22 (32%)
C2H2 Zn finger 601..618 CDD:275368 7/17 (41%)
C2H2 Zn finger 626..646 CDD:275368 6/20 (30%)
zf-H2C2_2 638..663 CDD:290200 10/25 (40%)
C2H2 Zn finger 654..674 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.