DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and LOC108191949

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_017214341.1 Gene:LOC108191949 ID: Length:247 Species:Danio rerio

Alignment Length:173 Identity:59/174 (34%)
Similarity:90/174 (52%) Gaps:13/174 (7%)


  Fly   234 CPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHS-----TERPFGC 293
            |..|..:||.:..:..|| .:| .||..|.||.|.|.|..:..|:.|.: ||:     .::.|||
Zfish    80 CKLCGFEFTYHSNMVRHM-RIH-TGETPYVCEICGKGFQRQDWLKEHFR-VHTGVKRKRKKTFGC 141

  Fly   294 QHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCS 358
            ..|:::|...|.|.|||..|.||   |.|.|.:|.||:.:.|||..|::  :.:.|:...|..|.
Zfish   142 DQCEKKFHGSTALQSHLNKHRGE---RPFPCVQCDKSFFSHSDLYRHIK--HCHSEKQHSCSLCG 201

  Fly   359 KAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVR 401
            ..|..|..|..|:.:||||:|::|.:|.|.:....:.:.|:.|
Zfish   202 NEFSRRTSLLKHMRIHTGERPYSCPHCGKTFPYKYSFDMHLKR 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 6/21 (29%)
C2H2 Zn finger 264..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 8/20 (40%)
zf-C2H2_8 305..373 CDD:292531 24/68 (35%)
C2H2 Zn finger 324..344 CDD:275368 8/20 (40%)
C2H2 Zn finger 354..374 CDD:275368 6/20 (30%)
zf-H2C2_2 366..389 CDD:290200 10/23 (43%)
C2H2 Zn finger 382..403 CDD:275368 5/21 (24%)
LOC108191949XP_017214341.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.