DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and znf1168

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_021325085.1 Gene:znf1168 ZFINID:ZDB-GENE-050208-703 Length:329 Species:Danio rerio

Alignment Length:296 Identity:92/297 (31%)
Similarity:129/297 (43%) Gaps:46/297 (15%)


  Fly   134 LMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPH----HQPETAELFAVEPPTPPESSEE 194
            |..:...||.:...::.||....|..:   ||..::.|.    .|.||.|...|     ..:|||
Zfish     5 LTRSFSVESSELSSAAISERQRQSLLK---DSEKMSDPEPCRIKQEETEEKIDV-----MVNSEE 61

  Fly   195 PAPDAAEKPKMRRARPRQDNVKPKERKASGAV---------------HPRSLH----------PC 234
            .:.| .||..:|.....|............||               .|..||          .|
Zfish    62 LSKD-EEKHHVRSETQTQSKTVRSFSMKRTAVKCFTCTLCGKGFSYNRPFKLHMMIHTGERPYKC 125

  Fly   235 PECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRR 299
            ..|:|:|::...||.| ..:| .||..|.|::|...|.....|:.|:: ||:.|:|:.|..|.:|
Zfish   126 SHCDKRFSQFGHLKSH-EMIH-TGEKPYTCDQCSNTFLRPSDLKIHLR-VHTNEKPYSCPECGKR 187

  Fly   300 FILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTR 364
            |.....|..|...|||   .|.|.|..|.|::.|...|:.|...|..  |:|:.|..|||.|...
Zfish   188 FAQHAHLKLHQHVHTG---VREFVCFECEKTFITAGHLKQHQMIHTG--EKPYTCSHCSKTFSHI 247

  Fly   365 GHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMV 400
            ||:|:|..||||||||||.:|.|.::...:||:||:
Zfish   248 GHMNAHERVHTGEKPFACTHCGKSFRVSSSLNSHML 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/21 (33%)
C2H2 Zn finger 264..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 6/20 (30%)
zf-C2H2_8 305..373 CDD:292531 25/68 (37%)
C2H2 Zn finger 324..344 CDD:275368 6/20 (30%)
C2H2 Zn finger 354..374 CDD:275368 10/20 (50%)
zf-H2C2_2 366..389 CDD:290200 15/23 (65%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)
znf1168XP_021325085.1 C2H2 Zn finger 97..117 CDD:275368 3/20 (15%)
SFP1 <114..201 CDD:227516 26/90 (29%)
C2H2 Zn finger 125..145 CDD:275368 7/21 (33%)
COG5048 <149..309 CDD:227381 55/142 (39%)
C2H2 Zn finger 153..173 CDD:275368 6/21 (29%)
C2H2 Zn finger 181..201 CDD:275368 6/20 (30%)
C2H2 Zn finger 209..229 CDD:275368 6/20 (30%)
C2H2 Zn finger 237..257 CDD:275368 10/20 (50%)
C2H2 Zn finger 265..285 CDD:275368 7/20 (35%)
C2H2 Zn finger 293..313 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.