DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and im:7147486

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005158213.1 Gene:im:7147486 ZFINID:ZDB-GENE-050208-286 Length:1266 Species:Danio rerio

Alignment Length:489 Identity:106/490 (22%)
Similarity:164/490 (33%) Gaps:144/490 (29%)


  Fly     5 LPHHPLVCRCCLLEQPPLYHSLYDASSQLAVELKALAPALRLEHGDNLTDVICDLCLRRLHDARD 69
            |..|..||...:|::..:.:.:.|....:.   |...|.             |.....|..:...
Zfish   715 LKEHLKVCEARILKEQTIENKIADLPGPIK---KFPCPQ-------------CGKFFSRKDNMNM 763

  Fly    70 FQRRCEHSE----QVLRMRHEHWKHTVAVGDALALDDVLE--CLEREV----------GSLEGPM 118
            .|::| |.:    .|:..|.|. |..||..:...|....|  .:::|.          |.:..|.
Zfish   764 HQKKC-HGKTAVPAVVSTRTEP-KTPVAQENLFVLSPSTENKAVQQETPQNTSSSRNWGIMSLPS 826

  Fly   119 SVP--------------------LQASKPVAHVAP-----LMETVDFES---LDFQDSSHSEHDI 155
            .:|                    ||.....:::.|     |...:|||:   |..|..|.:|   
Zfish   827 VLPRKVTCECGASFTCPRLLFEHLQQHAQESYICPHCGESLQSWMDFEAHQQLHKQSQSSNE--- 888

  Fly   156 PSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESS--EEPAPDAAEKPKMRRARPRQDNVKPK 218
                    ..|....||...:...|.|  |..||:|.  .|..|.|...||.....|   :..|.
Zfish   889 --------QRGPQQRPHTFSQALPLHA--PTRPPQSPGFSEHKPPALLPPKHLNNGP---DTAPL 940

  Fly   219 ERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMG----EMRYQCEECRKNFASRHSLRY 279
                          .||.|:|.|::...|..|: .:...|    :.::.|..|...|.:..:|:.
Zfish   941 --------------TCPRCKKNFSQRSSLARHI-RLRCTGDPTTQKKHPCTRCGATFLNPLNLKI 990

  Fly   280 HVKS--VHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMR 342
            ||:|  .....:|..|..|.|.|.....|..||.:|:.:|     .||.|.::.|....|..|.|
Zfish   991 HVQSNTCKPAFKPIRCPVCVRWFSCLDGLKRHLVSHSRQA-----VCQICDQNCPNLQALEEHKR 1050

  Fly   343 ------------------SHNPNMER----PFKCDRCSKAFFTRGHLNSHL-LVHTGEKP----- 379
                              |..|::|.    ||:|..|.:.:.....|..|| .||..::|     
Zfish  1051 KVHGLNNRLRPEENAPNLSSQPSVENTSVTPFQCHVCLRYYPKLQSLKDHLRKVHRPKQPKQNNL 1115

  Fly   380 ----------FACEYCDKCYQSVGNLNNHMVRLH 403
                      |.|:.|.:.|.::.:|.||..|:|
Zfish  1116 STTEPVRIGQFLCQICGRSYPTIKSLKNHRRRVH 1149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 12/75 (16%)
C2H2 Zn finger 234..255 CDD:275368 7/21 (33%)
C2H2 Zn finger 264..285 CDD:275368 7/23 (30%)
C2H2 Zn finger 293..313 CDD:275368 7/20 (35%)
zf-C2H2_8 305..373 CDD:292531 22/91 (24%)
C2H2 Zn finger 324..344 CDD:275368 8/38 (21%)
C2H2 Zn finger 354..374 CDD:275368 6/21 (29%)
zf-H2C2_2 366..389 CDD:290200 9/39 (23%)
C2H2 Zn finger 382..403 CDD:275368 7/21 (33%)
im:7147486XP_005158213.1 C2H2 Zn finger 18..38 CDD:275368
C2H2 Zn finger 53..72 CDD:275368
KAR9 <235..>395 CDD:285747
C2H2 Zn finger 702..730 CDD:275368 5/15 (33%)
C2H2 Zn finger 748..766 CDD:275368 4/31 (13%)
C2H2 Zn finger 835..853 CDD:275368 2/18 (11%)
C2H2 Zn finger 860..897 CDD:275368 11/48 (23%)
C2H2 Zn finger 942..962 CDD:275368 7/21 (33%)
C2H2 Zn finger 975..995 CDD:275368 7/20 (35%)
C2H2 Zn finger 1006..1026 CDD:275368 7/20 (35%)
C2H2 Zn finger 1032..1050 CDD:275368 6/18 (33%)
C2H2 Zn finger 1084..1105 CDD:275368 6/21 (29%)
C2H2 Zn finger 1128..1149 CDD:275368 7/21 (33%)
C2H2 Zn finger 1173..1194 CDD:275368
C2H2 Zn finger 1214..1232 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.