DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and znf329

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001123794.2 Gene:znf329 XenbaseID:XB-GENE-5965306 Length:463 Species:Xenopus tropicalis

Alignment Length:444 Identity:112/445 (25%)
Similarity:172/445 (39%) Gaps:107/445 (24%)


  Fly     7 HHPL-VCRCCLLE------QPPLYHSLYDASSQLAVELKALAPALRLEHGDNLTDVICDLCLRRL 64
            :||. .|:.|:||      .|||.||.:..|.:..:.|              :.::|..|     
 Frog    45 NHPKNRCKVCMLEGFCKHHTPPLGHSTFRESGKKILGL--------------INNIIFLL----- 90

  Fly    65 HDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVA 129
              ..:...|||  :..:....|.|::   :.:..||  ..|.::::        |:||.      
 Frog    91 --TEEVTVRCE--DVSVYFSKEEWEY---LHENKAL--YSEVIQKK--------SLPLY------ 132

  Fly   130 HVAPLME-TVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPP---- 189
                |:: ..||:|.|..::.:|..|||...|...|..|     ::.||....|:.|....    
 Frog   133 ----LLDWENDFDSKDNLNAEYSWDDIPCNSEDMADELS-----YEEETLLNSAISPAGQNSADY 188

  Fly   190 ------------ESSEEPAPDAA-----EKPKMRRARPRQ--------DNVKPKE------RKAS 223
                        |...:..||.:     |..|:......:        ..:|.||      .|::
 Frog   189 VTNNVYSKSVLYEDGTQTCPDISIITITEHMKIPNTATDKACSLNTPLSEIKGKENGKIITNKST 253

  Fly   224 GA----VHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSV 284
            .|    .:.::.:.|..|:|.|..|..|..|. ..| .||..:.|..|.|.:.....|..| :.:
 Frog   254 SASPLKKYTKATYTCGLCQKPFPCNRDLIRHQ-KFH-TGEKPFSCSVCGKCYRDNALLIRH-QRI 315

  Fly   285 HSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNME 349
            |:.:|.|.|..|.:.|:..:|||.|..:|||..:   ..|..|.|.:...|.|..|.|.|..  |
 Frog   316 HTADRLFPCSDCGKFFVDHSQLLIHQTSHTGAKR---HSCAECGKWFHYTSALIKHQRIHTG--E 375

  Fly   350 RPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403
            :||.|..|.|.|.....|..|..:|||||||:|..|.||:....:|:.|. |.|
 Frog   376 KPFSCSFCGKRFNDNSILTRHERIHTGEKPFSCTVCGKCFTRRSHLSEHQ-RSH 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 16/77 (21%)
C2H2 Zn finger 234..255 CDD:275368 7/21 (33%)
C2H2 Zn finger 264..285 CDD:275368 5/21 (24%)
C2H2 Zn finger 293..313 CDD:275368 7/20 (35%)
zf-C2H2_8 305..373 CDD:292531 24/68 (35%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..374 CDD:275368 6/20 (30%)
zf-H2C2_2 366..389 CDD:290200 13/23 (57%)
C2H2 Zn finger 382..403 CDD:275368 7/21 (33%)
znf329NP_001123794.2 KRAB_A-box 96..127 CDD:143639 8/38 (21%)
C2H2 Zn finger 268..288 CDD:275368 7/21 (33%)
zf-H2C2_2 280..303 CDD:290200 8/25 (32%)
COG5048 <292..446 CDD:227381 50/145 (34%)
zf-C2H2 294..316 CDD:278523 5/23 (22%)
C2H2 Zn finger 296..316 CDD:275368 5/21 (24%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
C2H2 Zn finger 352..372 CDD:275368 7/20 (35%)
zf-H2C2_2 364..388 CDD:290200 11/26 (42%)
C2H2 Zn finger 380..400 CDD:275368 6/20 (30%)
zf-H2C2_2 393..417 CDD:290200 13/24 (54%)
C2H2 Zn finger 408..428 CDD:275368 7/21 (33%)
C2H2 Zn finger 436..456 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4363
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.