DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and zgc:174624

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001120944.1 Gene:zgc:174624 ZFINID:ZDB-GENE-080516-3 Length:394 Species:Danio rerio

Alignment Length:186 Identity:72/187 (39%)
Similarity:102/187 (55%) Gaps:12/187 (6%)


  Fly   218 KERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVK 282
            |.:|......|   |.|.:|.|:|:::..|..|| .:| .||..:.|.:|.|:|:...||:.|: 
Zfish   185 KHKKIHTGEKP---HACTQCGKRFSQSSNLNQHM-RIH-TGEKPFTCTQCGKSFSHSSSLKLHM- 243

  Fly   283 SVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPN 347
            .:|:.|:.|.|..|...|.....|..||:||||| ||  |.|.:|.||:...:.|..||::|.. 
Zfish   244 MIHTGEKSFTCTQCGMSFSQSPSLYRHLKTHTGE-KP--FICTQCGKSFSQSAHLNLHMKTHTG- 304

  Fly   348 MERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403
             |:||.|.:|.|:|.....||.|:::||||||..|..|.|.:....|||.|| |:|
Zfish   305 -EKPFTCTQCGKSFNQSSDLNKHMIIHTGEKPLICTQCGKSFSCSSNLNKHM-RIH 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/21 (33%)
C2H2 Zn finger 264..285 CDD:275368 7/21 (33%)
C2H2 Zn finger 293..313 CDD:275368 7/20 (35%)
zf-C2H2_8 305..373 CDD:292531 29/68 (43%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 366..389 CDD:290200 12/23 (52%)
C2H2 Zn finger 382..403 CDD:275368 9/21 (43%)
zgc:174624NP_001120944.1 COG5048 52..>382 CDD:227381 72/187 (39%)
C2H2 Zn finger 58..78 CDD:275368
C2H2 Zn finger 86..106 CDD:275368
zf-H2C2_2 98..123 CDD:290200
C2H2 Zn finger 114..134 CDD:275368
zf-H2C2_2 126..151 CDD:290200
C2H2 Zn finger 142..162 CDD:275368
zf-H2C2_2 154..179 CDD:290200
C2H2 Zn finger 170..190 CDD:275368 2/5 (40%)
zf-H2C2_2 182..207 CDD:290200 8/25 (32%)
C2H2 Zn finger 198..218 CDD:275368 7/21 (33%)
zf-H2C2_2 210..235 CDD:290200 10/27 (37%)
C2H2 Zn finger 226..246 CDD:275368 7/21 (33%)
zf-H2C2_2 238..263 CDD:290200 9/26 (35%)
C2H2 Zn finger 254..274 CDD:275368 7/20 (35%)
zf-H2C2_2 266..291 CDD:290200 15/28 (54%)
C2H2 Zn finger 282..302 CDD:275368 7/20 (35%)
zf-H2C2_2 294..319 CDD:290200 11/27 (41%)
C2H2 Zn finger 310..330 CDD:275368 7/20 (35%)
zf-H2C2_2 322..347 CDD:290200 12/25 (48%)
C2H2 Zn finger 338..358 CDD:275368 9/21 (43%)
zf-H2C2_2 350..375 CDD:290200 7/11 (64%)
C2H2 Zn finger 366..386 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.