DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30431 and znf605

Sequence 1:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001090653.1 Gene:znf605 XenbaseID:XB-GENE-5942644 Length:2009 Species:Xenopus tropicalis

Alignment Length:430 Identity:97/431 (23%)
Similarity:144/431 (33%) Gaps:126/431 (29%)


  Fly    56 ICDLCLR--------RLHDARDFQRRCEHSEQVLRMRHEHWKH--------TVAVGDALALDDVL 104
            :|::|.:        :||........||....:.|.:....:|        |......|..|.:|
 Frog  1285 VCEVCGKSFRLPRYLQLHIVMHTGTPCESCGCLFRFKRRAGRHSKKCRLCRTRGKEQGLQPDTIL 1349

  Fly   105 ECLEREVGSLEGPMSVPLQASKPVAHVAPLMETVDFESLDFQDSSHSEHDI---PSYWESSVDSG 166
                     .:.|:.||   ..|.|.|        ..||.....|.:.:..   .::.|..  |.
 Frog  1350 ---------AQSPLVVP---DAPKAKV--------LSSLPHGKQSKAPNQAKRGKAFKEKK--SQ 1392

  Fly   167 SLNTPHHQPETAELFAVEP---PTPPESSEEPAPDAAEKPKMRRARPRQDNVKP-------KERK 221
            .|..|..|....:|...:|   ...|:..|:.:|...:|......:|..|.:..       |...
 Frog  1393 LLKGPSGQSRKRKLSLTQPEEGKKKPKRVEDLSPSTPKKRGRPPGKPSTDKMLSRLKTSAIKSES 1457

  Fly   222 ASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGE-------MRYQ---------------- 263
            .|.||....||| .|..|            ::|.|.|:       ..||                
 Frog  1458 KSIAVSGEGLHP-GETAK------------SSVSGEGKPIKSDEVPTYQILPTMSIKEEPNASEI 1509

  Fly   264 ----CEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRI--- 321
                |.||.:||..:|.|..|::: |:.:|||.|..||:||.....|..|.|.||| .:|.:   
 Frog  1510 SSFLCSECGQNFPYKHLLDSHLQT-HTGDRPFACPDCDKRFAKINHLTIHKRVHTG-VRPHVCSV 1572

  Fly   322 ----------------------------FECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCS 358
                                        :||..|.|.:...|||..|..|  ..:|.|.:|..|.
 Frog  1573 CNSSFRQKSSLLAHRYTHANQPPLLVTLYECSICLKEFKQSSDLEAHECS--LPVEPPVQCKDCD 1635

  Fly   359 KAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNH 398
            :.|..:|.|..|..|||.:..:.|..|::.:....||..|
 Frog  1636 RVFTNKGRLAVHSRVHTEQTSYPCPICERSFIYKANLERH 1675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 6/34 (18%)
C2H2 Zn finger 234..255 CDD:275368 3/21 (14%)
C2H2 Zn finger 264..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 8/20 (40%)
zf-C2H2_8 305..373 CDD:292531 24/99 (24%)
C2H2 Zn finger 324..344 CDD:275368 8/20 (40%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 366..389 CDD:290200 7/23 (30%)
C2H2 Zn finger 382..403 CDD:275368 5/18 (28%)
znf605NP_001090653.1 C2H2 Zn finger 42..62 CDD:275368
C2H2 Zn finger 70..90 CDD:275368
C2H2 Zn finger 1114..1134 CDD:275368
COG5048 1282..1704 CDD:227381 97/431 (23%)
C2H2 Zn finger 1286..1306 CDD:275368 4/20 (20%)
C2H2 Zn finger 1311..1329 CDD:275368 4/18 (22%)
C2H2 Zn finger 1514..1534 CDD:275368 8/21 (38%)
zf-H2C2_2 1527..1550 CDD:290200 11/24 (46%)
C2H2 Zn finger 1542..1562 CDD:275368 8/20 (40%)
zf-H2C2_2 1554..1579 CDD:290200 7/26 (27%)
C2H2 Zn finger 1570..1590 CDD:275368 0/20 (0%)
C2H2 Zn finger 1603..1623 CDD:275368 8/22 (36%)
C2H2 Zn finger 1631..1651 CDD:275368 7/20 (35%)
zf-H2C2_2 1644..1668 CDD:290200 7/24 (29%)
zf-C2H2 1657..1679 CDD:278523 5/20 (25%)
C2H2 Zn finger 1659..1679 CDD:275368 5/18 (28%)
zf-H2C2_2 1671..1696 CDD:290200 3/6 (50%)
C2H2 Zn finger 1687..1707 CDD:275368
C2H2 Zn finger 1716..1734 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.