DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Stambpl1

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001347645.1 Gene:Stambpl1 / 76630 MGIID:1923880 Length:436 Species:Mus musculus


Alignment Length:175 Identity:37/175 - (21%)
Similarity:67/175 - (38%) Gaps:54/175 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 NQRLSTRLY--CAVEMGVPGGTKGLMFSLVPLEISN-ENSDLVALRCI---------EKQSQQQA 184
            |:.::.|.|  ..|||.        ..:.|.||..| ||:.::..:.|         .:..||.|
Mouse    43 NEDITPRRYFRSGVEME--------RMASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCA 99

  Fly   185 SKQMERFVPELAQVVDATRDMQHRLDLVLRY---INDVLARKKKPDNVVGRSLYAA-----LTAV 241
            ..:.:..:.:|.::.....| :.:.||:.:|   ..:.|..|.|         |.|     |...
Mouse   100 VPEKQDIMKKLKEIAFPRTD-ELKTDLLRKYNIEYQEYLQSKNK---------YKAEILKKLEHQ 154

  Fly   242 PLLDSDKFRVMFNTNLRDMLMAITLSTMIKTQLEISEKLSCMQDQ 286
            .|:::::.|:               :.|.:.||| ||:....:||
Mouse   155 RLIEAERQRI---------------AQMRQQQLE-SEQFLFFEDQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 35/167 (21%)
Stambpl1NP_001347645.1 USP8_dimer 28..129 CDD:370218 20/94 (21%)
Tig <119..>195 CDD:223618 20/91 (22%)
MPN_AMSH_like 266..436 CDD:163697
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 347..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.