DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and Stambpl1

DIOPT Version :10

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_083958.3 Gene:Stambpl1 / 76630 MGIID:1923880 Length:436 Species:Mus musculus


Alignment Length:175 Identity:37/175 - (21%)
Similarity:67/175 - (38%) Gaps:54/175 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 NQRLSTRLY--CAVEMGVPGGTKGLMFSLVPLEISN-ENSDLVALRCI---------EKQSQQQA 184
            |:.::.|.|  ..|||.        ..:.|.||..| ||:.::..:.|         .:..||.|
Mouse    43 NEDITPRRYFRSGVEME--------RMASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCA 99

  Fly   185 SKQMERFVPELAQVVDATRDMQHRLDLVLRY---INDVLARKKKPDNVVGRSLYAA-----LTAV 241
            ..:.:..:.:|.::.....| :.:.||:.:|   ..:.|..|.|         |.|     |...
Mouse   100 VPEKQDIMKKLKEIAFPRTD-ELKTDLLRKYNIEYQEYLQSKNK---------YKAEILKKLEHQ 154

  Fly   242 PLLDSDKFRVMFNTNLRDMLMAITLSTMIKTQLEISEKLSCMQDQ 286
            .|:::::.|:               :.|.:.||| ||:....:||
Mouse   155 RLIEAERQRI---------------AQMRQQQLE-SEQFLFFEDQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 35/167 (21%)
Stambpl1NP_083958.3 USP8_dimer 28..132 CDD:462647 21/97 (22%)
HlpA <101..>176 CDD:442073 18/100 (18%)
MPN_AMSH_like 266..436 CDD:163697
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 347..360
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.