DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and psmd7

DIOPT Version :8

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001032349.1 Gene:psmd7 / 447971 XenbaseID:XB-GENE-1005422 Length:320 Species:Xenopus tropicalis

Alignment Length:272 Identity:65/273 (24%)
Similarity:123/273 (45%) Gaps:21/273 (8%)


  Fly    11 KVYLKPLVFFQIIDAYDRRPKGDNQ--VMGTLLGRNKEGHIEITNCFTVPHKEHSENKRI-DLDM 72
            :|.:.|||...::|.::|..|..||  |:|.|||...:..::::|.|.||..|..::..: .||.
 Frog     8 RVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWHKKILDVSNSFAVPFDEDDKDDSVWFLDH 72

  Fly    73 AYASEVLELNMFAYPN--ERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRL 135
            .|...:  ..||...|  ||::||:.||..:.::...|::...|.|  ...:.:::|...|:..|
 Frog    73 DYLENM--YGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYC--PNSVLVIIDVKPKDLGL 133

  Fly   136 STRLYCAVEMGVPGGT-KGLMFSLVPLEISNENSDLVA----LRCIEKQSQQQASKQMERFVPEL 195
            .|..|.:||.....|| ....|..|..||..|.::.|.    ||.|:..:....|::       :
 Frog   134 PTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQR-------I 191

  Fly   196 AQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLRDM 260
            ...|...:.:..:|..:..|:..|.:.|...::.:...|......:|.::..:|...|.....|.
 Frog   192 TNQVHGLKGLNSKLLDIRSYLEKVSSGKLPINHQIIYQLQDVFNLLPDVNLQEFVKAFYLKTNDQ 256

  Fly   261 LMAITLSTMIKT 272
            ::.:.|:::|::
 Frog   257 MLVVYLASLIRS 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 65/272 (24%)
psmd7NP_001032349.1 MPN_RPN7_8 7..285 CDD:163693 65/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.