DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and csn-6

DIOPT Version :8

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001255725.1 Gene:csn-6 / 178289 WormBaseID:WBGene00000818 Length:431 Species:Caenorhabditis elegans

Alignment Length:307 Identity:66/308 (21%)
Similarity:126/308 (41%) Gaps:44/308 (14%)


  Fly     7 SMRAKVYLKPLVFFQIIDAYDRR--PKGD--NQVMGTLLGRNKEGHIEITNCFTVPHKEHSENKR 67
            |..:||.|.|||..|:.:.|.|.  .:|.  .:|.|.:|||.....:|..|.|.:..:.....:.
 Worm     9 SCSSKVLLHPLVIMQMSEHYSRTKVQQGPTVKKVFGAILGRQNGRQVEAINSFVLKMETEEMAEP 73

  Fly    68 IDLDMAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKN 132
            :.....:..:..:..:..:|..:|:|.:|.|:..:.:.            |.:||...:..|::|
 Worm    74 VTFSTEHLLQRADQYLEVFPELQVIGLYCAGEDDNLTP------------EEKPLLSKLTNAVRN 126

  Fly   133 Q----RLSTRLYCAVEMGVPGGTKGL-MFSL----------VPLE--ISNENSDLVALRCIEKQS 180
            .    ::...|:..:.....|.|:.| :|:.          .|:|  :.:|.|:.|.:..|.|.|
 Worm   127 SEKAGQIDATLFLKLNSITAGTTRKLPLFAFEADVTDQEKHKPIEWILVSEESERVGVNHIAKLS 191

  Fly   181 QQQASKQMERFVPELAQVVDATRDM-QHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLL 244
            .:. .|..:....:.|:..||...| |:|:||::.|:..|.....:|:..:.:.  |.|.|..|.
 Worm   192 TKH-GKDGKSVGKKHAEAQDAAMSMLQNRVDLIVAYLEKVQDGTLQPNFEILKE--ANLLAQKLK 253

  Fly   245 DSDKFRVMFNTNLRDMLMAIT-------LSTMIKTQLEISEKLSCMQ 284
            ..|::...|..:.......:|       |:|::.....:..|||..:
 Worm   254 TIDRYAAEFTDSFEKEEKTMTVFSLMPRLTTLLGNMQNVWNKLSAQR 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 62/297 (21%)
csn-6NP_001255725.1 MPN 13..269 CDD:301301 59/271 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.