DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and Trub1

DIOPT Version :8

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_008758760.1 Gene:Trub1 / 361775 RGDID:1308502 Length:345 Species:Rattus norvegicus

Alignment Length:316 Identity:67/317 (21%)
Similarity:114/317 (36%) Gaps:76/317 (24%)


  Fly     5 KVYDAATVFKHM--NGILNVYKPSGMKVKHVRNAILSNICKGLN--------EMEQRKPRKLQEN 59
            :|..||...|.|  :|:..|:||.|.....:.|.:...:..|..        |..:|:.:.|:  
  Rat    46 QVSKAALAAKLMSLSGVFAVHKPKGPTSAELLNRLKEKLLAGTRPEAGLPSPEWNKRQKQTLK-- 108

  Fly    60 ISLLGTGTAADHVLHNIGEQTDLSDHLLSTGPRYLPRDLICTTVSSLGDHTSGVLLFGINRGAGQ 124
               :|.|                                     .:|.....|||:.||.||...
  Rat   109 ---VGHG-------------------------------------GTLDSAAQGVLVVGIGRGTKM 133

  Fly   125 SSSIRKNRPVRVYHLIGHLGIATENNLPDSRVIMRSNHRHVSADRISSLAAS-----MQASHQRK 184
            .:|:....  :.|...|.||.||:......:|.....:..::.:.|..:...     ||......
  Rat   134 LTSMLSGS--KRYIATGELGKATDTLDSTGKVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYS 196

  Fly   185 MFELCGVDLQTQEAYELACRGLLRPADDSQPV-VYGIKLIHFDRPHFTLELHAINETQEYLATLV 248
            ..:..|..|.|     |..||....|..::|| |:.|.|:.:..|.|||::......  |:.:||
  Rat   197 ALKKDGQRLST-----LMKRGETVEARPARPVTVHSISLLKYQPPFFTLDVECGGGF--YIRSLV 254

  Fly   249 HDMALDLRTVAHCSQLRCVRHAHFDVTDSLLRHA-----WHLPGIIKNLRQQRDIL 299
            .|:..:|.:.|...:|...:...|    :|.:||     |.:..|.::|::...:|
  Rat   255 SDIGKELSSCATVLELTRTKQGPF----TLAQHALPEDRWTINDIAQSLKRCTSLL 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 60/293 (20%)
Trub1XP_008758760.1 PseudoU_synth 61..340 CDD:294089 62/302 (21%)
TruB 61..282 CDD:129523 56/276 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1535798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.