DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and TRUB2

DIOPT Version :8

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_056494.1 Gene:TRUB2 / 26995 HGNCID:17170 Length:331 Species:Homo sapiens

Alignment Length:302 Identity:98/303 (32%)
Similarity:164/303 (54%) Gaps:32/303 (11%)


  Fly    16 MNGILNVYKPSGMKVKHVRNAILSNICKGLNEMEQRKPRKLQENIS-LLGTGTAADHVLHNIGEQ 79
            ::|:..||||.|:|.||:|:.:...:.||||   .|||...::.:. |||....:        |:
Human     9 LHGLFAVYKPPGLKWKHLRDTVELQLLKGLN---ARKPPAPKQRVRFLLGPMEGS--------EE 62

  Fly    80 TDLSDHLLSTG-PRYLPRDLICTTVSS---------LGDHTSGVLLFGINRGAGQSSSIRKNRPV 134
            .:|:  |.:|. |.::...|:|....:         |....||||:.|:..|....:.:......
Human    63 KELT--LTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLT 125

  Fly   135 RVYHLIGHLGIATENNLPDSRVIMRSNHRHVSADRISSLAASMQASHQRKMFELCGVDLQTQEAY 199
            :.|.:.|.||.||::...|.|::.::.:.||:.:::..:.|.:|.|||:.:.....:||:|||||
Human   126 KDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAY 190

  Fly   200 ELACRGLLRPADDSQPVVYGIKLIHFDRPHFTLELHAINETQEYLATLVHDMALDLRTVAHCSQL 264
            |:|.|||:||.:.|..::.||:.::|..|.|.||:..::|||:.|..|||::.|:|:|.|.|:|:
Human   191 EMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQV 255

  Fly   265 RCVRHAHFDVTDSLLRHAWHLPGIIKNLRQQRDILR-AHPQL 305
            |..|...|.:..:|||..|.|..|       :|.:| |.||:
Human   256 RRTRDGFFTLDSALLRTQWDLTNI-------QDAIRAATPQV 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 93/285 (33%)
TRUB2NP_056494.1 PseudoU_synth_hTruB2_like 11..283 CDD:211345 94/292 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167637694
eggNOG 1 0.900 E1_COG0130
Hieranoid 1 1.000
Homologene 1 1.000 H41056
Inparanoid 1 1.050 155 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1535798at2759
OrthoFinder 1 1.000 FOG0006228
OrthoInspector 1 1.000 T1072861
orthoMCL 1 0.900 OOG5_134667
Panther 1 1.100 LDO PTHR13195
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4283
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.