DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and Dkc1

DIOPT Version :8

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001346340.1 Gene:Dkc1 / 245474 MGIID:1861727 Length:534 Species:Mus musculus

Alignment Length:106 Identity:24/107 (22%)
Similarity:42/107 (39%) Gaps:20/107 (19%)


  Fly   217 VYGIKLIHFDRPHFTLELHAIN-ETQEYLATLVHDMALDLRTVAHCSQLRCVRHA------HFDV 274
            :|..|:|.:| |...|.:..:: |...|:.||...:.|.|.......:||.||..      |...
Mouse   224 IYESKMIEYD-PERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVT 287

  Fly   275 TDSLLRHAW---------HLPGIIKNLRQQRDILRAHPQLL 306
            ...:|...|         :|..::..|.:   :|.:|.:|:
Mouse   288 MHDVLDAQWLYDNHKDESYLRRVVYPLEK---LLTSHKRLV 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 20/91 (22%)
Dkc1NP_001346340.1 TruB_N 81..406 CDD:332368 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.