DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and Y43B11AR.3

DIOPT Version :8

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_501102.4 Gene:Y43B11AR.3 / 177480 WormBaseID:WBGene00021544 Length:335 Species:Caenorhabditis elegans

Alignment Length:294 Identity:74/295 (25%)
Similarity:127/295 (43%) Gaps:21/295 (7%)


  Fly    12 VFKHMNGILNVYKPSGMKVKHVRNAILSNICKGLNEMEQRKPRKLQENISLLGTGTAADH----- 71
            ::|.::|:|.|||.||:....:...|...|.:.::::|...  ::|  :.|:.......|     
 Worm     6 IWKSLSGVLCVYKHSGISSAGLIKLITRKIAESVSDIESTS--RIQ--LPLISIPVIEAHEKSGA 66

  Fly    72 -VLHNIGEQTDLSDHLLSTGPRYLPRDLICTTVSSLGDHTSGVLLFGINRGAGQSSSIRKNRPVR 135
             |:....|..|...|.|.:|......|:....|..|..::|||.|||:|.|......:.......
 Worm    67 LVVVGRNEVADYRYHPLVSGRSIRQEDIQLVDVLPLATNSSGVCLFGVNDGCESIPELMSKSWTN 131

  Fly   136 VYHLIGHLGIATENNLPDSRVIMRSNHRHVSADRISSLAASMQASHQRKMFELCGVDLQTQEAYE 200
            ||.:.|.  |....|:..|::   |.|      ||..:.:.:::..:...|....||:::.||:|
 Worm   132 VYRIDGI--IKKSENIDVSKI---SKH------RIEKVLSRLESEFRSASFRHANVDMESSEAFE 185

  Fly   201 LACRGLLRPADDSQPVVYGIKLIHFDRPHFTLELHAINETQEYLATLVHDMALDLRTVAHCSQLR 265
            ||.||:.|.......:||.|.|..|..|.|::......|..|.|..|:..:..:|.|.:...:|:
 Worm   186 LARRGVPRAQLPGSQIVYSIDLNWFRSPKFSVTTQCSGEDDEMLRQLIEHIGSNLGTESTTIRLQ 250

  Fly   266 CVRHAHFDVTDSLLRHAWHLPGIIKNLRQQRDIL 299
            ......|...::||....:|..|.:|:...|.|:
 Worm   251 RQNFGPFGSDNALLEKQINLQNIARNIILNRKII 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 71/280 (25%)
Y43B11AR.3NP_501102.4 PseudoU_synth 12..277 CDD:294089 71/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167630293
eggNOG 1 0.900 E1_COG0130
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I3711
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1535798at2759
OrthoFinder 1 1.000 FOG0006228
OrthoInspector 1 1.000 T474288
orthoMCL 1 0.900 OOG5_134667
Panther 1 1.100 LDO PTHR13195
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4283
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.