DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and K01G5.5

DIOPT Version :8

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_499370.1 Gene:K01G5.5 / 176504 WormBaseID:WBGene00010478 Length:445 Species:Caenorhabditis elegans

Alignment Length:169 Identity:40/170 (24%)
Similarity:63/170 (37%) Gaps:28/170 (16%)


  Fly   165 VSADRISSLAASMQASHQR-----KMFELCGVDLQTQEAYELACRGLL-RPADDSQPV------- 216
            |..||.:.||.|.|.:.:.     |:.|....|.:.::|.|.....|. ||     |:       
 Worm   122 VCIDRTTRLAKSQQGAGKEYICIFKLHEEVEDDRKVKQALEKLTGALFQRP-----PLISAVKRQ 181

  Fly   217 -----VYGIKLIHFDRPHFTLELHAINETQEYLATLVHDMALDLRTVAHCSQLRCVRHAHFDVTD 276
                 ||..|.|.:|........:.|.|:..|:.|:...:.|.|.......:||..|....|..:
 Worm   182 LRIRTVYENKFIEYDPAQQMGIFNCICESGTYVRTICVHLGLILGCGGQMQELRRNRSGICDENE 246

  Fly   277 SLLR-----HAWHLPGIIKNLRQQRDILRAHPQLLRQQR 310
            :::.     .|.:|....|:....|.|:|....||.|.:
 Worm   247 NMVTMHDVLDAQYLLDTQKDESYMRHIVRPLEALLTQHK 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 34/150 (23%)
K01G5.5NP_499370.1 DKCLD 38..94 CDD:285330
CBF5 44..369 CDD:273073 40/170 (24%)
PseudoU_synth_hDyskerin 76..258 CDD:211338 32/141 (23%)
PUA 285..358 CDD:279774 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.