DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14591 and TMEM164

Sequence 1:NP_001188864.1 Gene:CG14591 FlyBaseID:FBgn0033054 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001340778.1 Gene:TMEM164 HGNCID:26217 Length:297 Species:Homo sapiens

Alignment Length:265 Identity:105/266 (39%)
Similarity:157/266 (59%) Gaps:15/266 (6%)


  Fly     4 DWAVGGISDEIPRTTGPECINYMTDRRRWLE-----TILLSALFIFIMHRSWQRLAPIKLPP--- 60
            ||..||:........||:|..:::.::|.||     |:.|..:.:.:.|...|.....:..|   
Human    11 DWLYGGVDPSFAGNGGPDCAAFLSWQQRLLESVVVLTLALLEILVALRHILRQTKEDGRGSPGSQ 75

  Fly    61 PHEI-QKP----HSPTRLFLLIALSMIFGIEMGFKLSGQSMIFALNPCHVQSCLQIYLLAAKPTK 120
            |.:: |:|    .|.::..||:||.:.||:|:|||.:.:::|:.|||||:.:.:.|:|||..|.:
Human    76 PEQVTQRPEEGKESLSKNLLLVALCLTFGVEVGFKFATKTVIYLLNPCHLVTMMHIFLLACPPCR 140

  Fly   121 TTTALFRIQMSNLNGPFLAFLFPEVEGRTYPFEQATYWIQHALLYIIPIYII-RSGAYTVEDLSE 184
            ....:|::||..|||..||.|||.|..|..|||...|:|||.:||::|||:: :.||||.|.||.
Human   141 GAIVVFKLQMHMLNGALLALLFPVVNTRLLPFELEIYYIQHVMLYVVPIYLLWKGGAYTPEPLSS 205

  Fly   185 FHWSHIGTAFMLFYHFILLSPLSIFTGINLDHMLCAAMSDPFQGSNYRIFACCHQALLCPLLSKG 249
            |.|:.:.|..|.||||.:|..|.:.|.:||::|||.|:||||.|..|||:|..||.|:.....| 
Human   206 FRWALLSTGLMFFYHFSVLQILGLVTEVNLNNMLCPAISDPFYGPWYRIWASGHQTLMTMTHGK- 269

  Fly   250 TVVLF 254
            .|:||
Human   270 LVILF 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14591NP_001188864.1 TMEM164 3..252 CDD:291474 103/262 (39%)
TMEM164NP_001340778.1 TMEM164 10..273 CDD:317245 103/263 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239603275
eggNOG 1 0.900 E1_28PNH
Hieranoid 1 1.000
Homologene 1 1.000 H12985
Inparanoid 1 1.050 193 1.000 Inparanoid score I3789
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1509337at2759
OrthoFinder 1 1.000 FOG0005688
OrthoInspector 1 1.000 T1072922
orthoMCL 1 0.900 OOG5_133271
Panther 1 1.100 LDO PTHR20948
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2989
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.