DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14591 and C35C5.10

Sequence 1:NP_001188864.1 Gene:CG14591 FlyBaseID:FBgn0033054 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001123115.1 Gene:C35C5.10 WormBaseID:WBGene00007959 Length:318 Species:Caenorhabditis elegans

Alignment Length:249 Identity:88/250 (35%)
Similarity:139/250 (56%) Gaps:11/250 (4%)


  Fly     3 WDWAVGGISDEIPRTTGPECINYMTDRRRWLETILLSALFIFIMHRSWQRLAPIKLPPPHEIQKP 67
            |:.|:|||...|....|.||:||:...:|:||:|      :||....|  .|.:.:|.......|
 Worm    30 WELAIGGIDSSIQGNGGEECMNYLPSWQRFLESI------VFIPLSFW--AAYMSIPLDCSFTLP 86

  Fly    68 -HSPTRLFLLIALSMIFGIEMGFKLSGQSMIFALNPCHVQSCLQIYLLAAKPT-KTTTALFRIQM 130
             .:.:|..:|...|:|||.|:.:|:..::.||.||||||.:.:|:.||..:.| |....|||:.:
 Worm    87 TRNVSRYVILTVYSLIFGAELAYKMISRTGIFLLNPCHVTTTMQLMLLTMEGTSKKACFLFRLML 151

  Fly   131 SNLNGPFLAFLFPEVEGRTYPFEQATYWIQHALLYIIPIYIIR-SGAYTVEDLSEFHWSHIGTAF 194
            ..:.|.:.|..||.:..|..|.|...|:.||..:.::|:|::. .||:..|...:|.|:..|.:.
 Worm   152 YFMPGAWFALAFPILNTRNLPGEVFIYYAQHVAILVVPVYLMYIQGAFEPEKPYDFGWTVFGISL 216

  Fly   195 MLFYHFILLSPLSIFTGINLDHMLCAAMSDPFQGSNYRIFACCHQALLCPLLSK 248
            ...|||::|...::.|.:||::::|.|:|||||...|||.|..||.:|.|:|||
 Worm   217 FSLYHFVILQFGAMVTRVNLNNIMCPAVSDPFQSRAYRIIAVGHQCILIPILSK 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14591NP_001188864.1 TMEM164 3..252 CDD:291474 88/250 (35%)
C35C5.10NP_001123115.1 TMEM164 30..274 CDD:291474 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239598240
eggNOG 1 0.900 E1_28PNH
Hieranoid 1 1.000
Homologene 1 1.000 H12985
Inparanoid 1 1.050 160 1.000 Inparanoid score I2841
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1509337at2759
OrthoFinder 1 1.000 FOG0005688
OrthoInspector 1 1.000 T474880
orthoMCL 1 0.900 OOG5_133271
Panther 1 1.100 LDO PTHR20948
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2989
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.