DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14591 and Tmem164

Sequence 1:NP_001188864.1 Gene:CG14591 FlyBaseID:FBgn0033054 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001186289.1 Gene:Tmem164 MGIID:2148020 Length:296 Species:Mus musculus

Alignment Length:272 Identity:107/273 (39%)
Similarity:155/273 (57%) Gaps:30/273 (11%)


  Fly     4 DWAVGGISDEIPRTTGPECINYMTDRRRWLE-----TILLSALFIFIMH-----------RSWQR 52
            ||..||:........||:|..:::.::|.||     |:.|..:.:.:.|           ||.| 
Mouse    11 DWLYGGVDPSFAGNGGPDCAAFLSWQQRLLESVVVLTLALLEILVALRHILRQKEDGRGGRSSQ- 74

  Fly    53 LAPIKLPPPHEIQKP----HSPTRLFLLIALSMIFGIEMGFKLSGQSMIFALNPCHVQSCLQIYL 113
                   |....|:|    .|.::..||:||.:|||:|:|||.:.:::|:.|||||:.:.:.|:|
Mouse    75 -------PQQVTQRPEEGKESLSKNLLLVALCLIFGVEVGFKFATKTVIYLLNPCHLVTMMHIFL 132

  Fly   114 LAAKPTKTTTALFRIQMSNLNGPFLAFLFPEVEGRTYPFEQATYWIQHALLYIIPIYII-RSGAY 177
            ||..|....|.:|::||..|||..||.|||.|..|..|||...|:||||:||::|:|:: :.|||
Mouse   133 LACPPCPGATVIFKLQMHMLNGALLALLFPVVNTRLLPFELEIYYIQHAMLYVVPVYLLWKGGAY 197

  Fly   178 TVEDLSEFHWSHIGTAFMLFYHFILLSPLSIFTGINLDHMLCAAMSDPFQGSNYRIFACCHQALL 242
            |.|.|..|.|:.:.|..|.||||..|..|.:.|.:||::|||.|:||||.|..|||:|..||.|:
Mouse   198 TPEPLCNFQWALLSTGLMFFYHFSFLQILGLVTEVNLNNMLCPAISDPFYGPWYRIWASGHQTLM 262

  Fly   243 CPLLSKGTVVLF 254
            .....| .|:||
Mouse   263 TMTHGK-LVILF 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14591NP_001188864.1 TMEM164 3..252 CDD:291474 105/269 (39%)
Tmem164NP_001186289.1 TMEM164 10..272 CDD:291474 105/270 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239601860
eggNOG 1 0.900 E1_28PNH
Hieranoid 1 1.000
Homologene 1 1.000 H12985
Inparanoid 1 1.050 196 1.000 Inparanoid score I3787
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1509337at2759
OrthoFinder 1 1.000 FOG0005688
OrthoInspector 1 1.000 T1082995
orthoMCL 1 0.900 OOG5_133271
Panther 1 1.100 LDO PTHR20948
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2989
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.