DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14591 and tmem164

Sequence 1:NP_001188864.1 Gene:CG14591 FlyBaseID:FBgn0033054 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_021324931.1 Gene:tmem164 ID: Length:315 Species:Danio rerio

Alignment Length:262 Identity:107/263 (41%)
Similarity:156/263 (59%) Gaps:17/263 (6%)


  Fly     4 DWAVGGISDEIPRTTGPECINYMTDRRRWLETILLSALFIFIMHRSWQRLAPIKLPPPHEIQ--- 65
            ||..||:........||||..:::.|:|.|||:::  :|..::.   ..||..||..|.|::   
Zfish    36 DWMYGGVDPMFEGNGGPECAAFISPRQRLLETLII--VFFSVLE---VLLALKKLSFPKEVRDVG 95

  Fly    66 --------KPHSPTRLFLLIALSMIFGIEMGFKLSGQSMIFALNPCHVQSCLQIYLLAAKPTKTT 122
                    |..|..:..||:||.|.||:|:|||.:.:::|:.||||||.:.:||:|||..|:||.
Zfish    96 KDGRRNNVKVDSWGKNLLLVALCMTFGVEVGFKFATKTVIYLLNPCHVVTMVQIFLLACPPSKTA 160

  Fly   123 TALFRIQMSNLNGPFLAFLFPEVEGRTYPFEQATYWIQHALLYIIPIYIIR-SGAYTVEDLSEFH 186
            ..:||:|:..|||..||.|||.|..|..|||:..|:|||::||::|||:.| .|.|..|.||:..
Zfish   161 MVIFRLQVHMLNGALLALLFPVVNTRLLPFEKEIYYIQHSMLYLVPIYLFRKGGVYKPEPLSDMW 225

  Fly   187 WSHIGTAFMLFYHFILLSPLSIFTGINLDHMLCAAMSDPFQGSNYRIFACCHQALLCPLLSKGTV 251
            |:.:.|..:..|||:.|..|.:.|.:||::|||.|:||||.|..||::|..||..|..:..|...
Zfish   226 WALLSTGILFLYHFVFLQGLGMLTEVNLNNMLCPAVSDPFYGPWYRVWATAHQTALTLVHGKTLT 290

  Fly   252 VL 253
            ||
Zfish   291 VL 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14591NP_001188864.1 TMEM164 3..252 CDD:291474 105/260 (40%)
tmem164XP_021324931.1 TMEM164 35..291 CDD:317245 105/260 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C239602715
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H12985
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1509337at2759
OrthoFinder 1 1.000 FOG0005688
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR20948
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2989
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.