DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and AT2G31820

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_180741.1 Gene:AT2G31820 AraportID:AT2G31820 Length:662 Species:Arabidopsis thaliana

Alignment Length:561 Identity:106/562 (19%)
Similarity:181/562 (32%) Gaps:206/562 (37%)


  Fly    85 ELEALFAKIKMGGEGPIGSTTTTTTTTSSRSRPPSLNGVSFRSTQPFK----ATASNAGKRSSTL 145
            ||:.|.:|..:.||.|:.:...              ||.|....:..|    .|||.|.:..   
plant   177 ELKELLSKQNLEGETPLYTAAE--------------NGHSIVVEEMLKHMDLETASIAARNG--- 224

  Fly   146 VKTEQTTVTQKNGRTVTQHLETHRVDLKGSRPKATWASFASTANSSTSSYVSPYRQKPSMAITC- 209
              .:...|..|.|     |||..::.|:      |:.:.|.|.:.|.::.:.....:..:.:.. 
plant   225 --FDPFHVAAKQG-----HLEVLKILLE------TFPNLAMTTDLSCTTALHTAATQGHIDVVNL 276

  Fly   210 ---TSPNI-KTPKTTSSTSSSSASSITSPPKPSSSVSSISSIFKSAPK---QVDKPLSSTATPKP 267
               |..|: |..|....|:..||:.:       ..|..:.|:....|.   :.||   ...|...
plant   277 LLETDSNLAKIAKNNGKTALHSAARM-------GHVEVVKSLIGKDPSIGFRTDK---KGQTALH 331

  Fly   268 FISLGSSGG-----TKPKVTAVAQSQDAQGT----ISTSLG--------ISKSSLTKNKLKPA-- 313
            ....|.:.|     .||.| ||...:|.:|.    |:|:.|        :|...:..|.:..|  
plant   332 MAVKGQNDGIVVELVKPDV-AVLSVEDNKGNTPLHIATNKGRIKIVRCLVSFEGINLNPINKAGD 395

  Fly   314 -----RVYIFNHERFDNKNEFRKGSAQDV-------KVLRATFEQLKCKVE-------------- 352
                 ...|.|.|......|....:|:|:       |.|:.|...:|.:|:              
plant   396 TPLDVSEKIGNAELVSVLKEAGAATAKDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQ 460

  Fly   353 ----------------VITDATLVTIKKTVRMLQTKDF-----------EDKSALVLVILSHGTR 390
                            .|..||:|.:     ::.|..|           ||:|...|:..:|   
plant   461 KIAKRLKKLHISGLNNAINSATVVAV-----LIATVAFAAIFTIPGQYEEDRSKGELLGQAH--- 517

  Fly   391 HDQIAAKD--------DDYSLDDDVVFPILRNRTL----KDKPKLIFVQACKGDCQLGGFMTDAA 443
               ||.|.        |..:|...:...:::...:    |.|.||:||                 
plant   518 ---IANKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKAKKKLVFV----------------- 562

  Fly   444 QPNGSPNEILKCYSTY--EGFVSF------RTE----------DGTPFIQTL-----CEALNRSG 485
                 .|:::.|...:  ..|||.      :.|          .||..:.|:     |..::|..
plant   563 -----INKLMWCACLFISIAFVSLSYIVVGKEEMWLAVCATVIGGTIMLTTIGAMCYCVVMHRME 622

  Fly   486 KTSDIDTIMMNVRQVVKMQSKDR-----QIPSVTSTLTSKY 521
            ::        .:|.:.|.:||.:     ::||.:..|..:|
plant   623 ES--------KLRSIRKERSKSQSFSMSRMPSDSDILNGEY 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 53/307 (17%)
AT2G31820NP_180741.1 ANK repeat 150..186 CDD:293786 4/9 (44%)
Ank_4 151..206 CDD:290365 10/43 (23%)
ANK 185..312 CDD:238125 31/164 (19%)
ANK repeat 188..222 CDD:293786 11/48 (23%)
ANK repeat 223..254 CDD:293786 10/47 (21%)
Ank_2 228..318 CDD:289560 21/108 (19%)
ANK repeat 256..289 CDD:293786 4/33 (12%)
ANK 290..413 CDD:238125 27/134 (20%)
ANK repeat 291..323 CDD:293786 6/39 (15%)
ANK repeat 325..357 CDD:293786 8/33 (24%)
Ank_2 330..418 CDD:289560 19/89 (21%)
ANK repeat 359..391 CDD:293786 6/32 (19%)
PGG 473..585 CDD:290670 27/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
10.910

Return to query results.
Submit another query.