DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and caspxa

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001077331.1 Gene:caspxa ID: Length:345 Species:Danio rerio

Alignment Length:234 Identity:68/235 (29%)
Similarity:111/235 (47%) Gaps:30/235 (13%)


  Fly   300 ISKSSLTKNKLKPARV-YIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIK 363
            :|:..:|:|   |..: .|.|:..|.:..| |:||.:|.|.|...|..|..:|....:.|...:|
Zfish   103 VSQYKITQN---PRGICVIINNVDFTSMKE-RRGSDEDQKYLAKVFRWLGFEVVAHRNKTAAEMK 163

  Fly   364 KTVRML-QTKDFEDKSALVLVILSHGTRHDQIAAKDDDYSLDDDVVFPI--LRNRTLKDKPKLIF 425
            ..::.| :|.|.:   ..|..:||||.: :.:...|.|....|::..|.  :..:.|..||||.|
Zfish   164 NILQALGRTVDGD---CFVCCVLSHGMK-EGVCGTDGDLVSVDEIRDPFTGINCQKLVGKPKLFF 224

  Fly   426 VQACKG-------DCQLGGFMTDAAQPNG--------SPNEILKCYSTYEGFVSFRTED-GTPFI 474
            :|||:|       :.|..|......:.:|        |..:.|...||.:|.:|:|..| |:.||
Zfish   225 IQACRGLRKQLCVNAQADGDGESEMEVDGDDFEITIPSDTDFLIARSTTDGHLSYREPDKGSWFI 289

  Fly   475 QTLCEALNRSGKT-SDIDTIMMNVRQVVKMQS-KDRQIP 511
            |:||..|.:.... :||.||:::|...|.:|. ..:|:|
Zfish   290 QSLCRNLEKHCPLGADIQTILLSVNNEVSIQGLHSKQMP 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 65/224 (29%)
caspxaNP_001077331.1 CARD 10..82 CDD:260018
CASc 106..341 CDD:237997 67/232 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.