DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and LOC733553

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_017947618.1 Gene:LOC733553 XenbaseID:XB-GENE-5812048 Length:244 Species:Xenopus tropicalis

Alignment Length:224 Identity:63/225 (28%)
Similarity:101/225 (45%) Gaps:43/225 (19%)


  Fly   330 RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIK----KTVRMLQTKDFEDKSALVLVILSHGTR 390
            |||..:||..|.....:|..||.:..|.:...||    |..:|.|.:.|      :.::.|||..
 Frog    31 RKGVKRDVNRLFKVLSRLGYKVSLHMDVSAKEIKDIYQKESKMPQGESF------ISILSSHGNE 89

  Fly   391 HDQIAAKDDDYS----LDD--DVVFPILRNRT--LKDKPKLIFVQACKGD-CQLGGFM------- 439
                ....|.|.    |.|  |::.|   |.:  |...|||.|||||:|: ...|.|:       
 Frog    90 ----GLIYDFYGTPVLLRDLYDILAP---NNSPLLAGVPKLFFVQACRGEQFDEGVFLETDGDTC 147

  Fly   440 -TDAAQPN-GSPNEILKCYSTYEGFVSFRTEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVV- 501
             |||...: ..|.:.:..:::.||.|:|:...|:.|:||||..|....:..:::.|:..:..:| 
 Frog   148 ATDAFSLSLNLPRDSVLMFASSEGHVAFQNPGGSVFLQTLCNLLEGEERNLELNRILTRLAHMVA 212

  Fly   502 -KMQSKD-----RQIPSVTSTLTSK-YVF 523
             ..||:.     :::|..|:.||.: |.|
 Frog   213 YTFQSQGQYGGFKEMPCYTTNLTRELYPF 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 62/223 (28%)
LOC733553XP_017947618.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.