DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and casp3b

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001041531.2 Gene:casp3b ZFINID:ZDB-GENE-070607-1 Length:285 Species:Danio rerio

Alignment Length:293 Identity:84/294 (29%)
Similarity:128/294 (44%) Gaps:61/294 (21%)


  Fly   278 KPK--VTAVAQSQDAQGTIS-TSLGI----SKSSLTKN---KLKP-----ARVYIFNHERFDNKN 327
            |||  .|..|:..||:.:.| |..|:    :||....|   :.|.     .:..|.|::.|..:.
Zfish     5 KPKGVDTVDARQSDAKESSSVTDPGLVQMDAKSHSDDNVDYQYKTNYPNLGQCLIINNKNFHKRT 69

  Fly   328 EF--RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFED--KSAL-VLVILSH 387
            ..  |.|:.:|.|.:..||.||..||....|   :|:.:.:.:|.....||  |||: ..|:|||
Zfish    70 GMGVRNGTDEDAKKVFETFSQLGFKVGHYND---LTVSQMMALLNKASQEDHSKSAMFACVLLSH 131

  Fly   388 GTRHDQIAAKDDD--YSLDDDVVFPIL-------RNRTLKDKPKLIFVQACKG-------DCQLG 436
            |         ||.  |..|:.:....|       |..:|..||||.|:|||:|       :|.  
Zfish   132 G---------DDGLIYGTDNSIELKRLFAHFRGDRCTSLVGKPKLFFIQACRGTDLDSGIECD-- 185

  Fly   437 GFMTDAAQPNGSPNEILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQV 500
            |...:..|......:.|..|||..|:.::| ..:|:.||.:||:.|.:.||..:|..:|..|...
Zfish   186 GVGDEETQRIPVEADFLYAYSTAPGYYAWRNVANGSWFISSLCDMLLKYGKQLEIMQVMTRVNHK 250

  Fly   501 VKMQSKD----------RQIPSVTSTLTSKYVF 523
            |.::.:.          :|||.:.|.||.:..|
Zfish   251 VALEFESSSNLPGFDGKKQIPCIVSMLTKELYF 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 70/249 (28%)
casp3bNP_001041531.2 CASc 47..284 CDD:237997 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.