DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and casp10

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_685430.4 Gene:casp10 ZFINID:ZDB-GENE-070608-2 Length:520 Species:Danio rerio

Alignment Length:424 Identity:103/425 (24%)
Similarity:162/425 (38%) Gaps:88/425 (21%)


  Fly   145 LVKTEQTTVTQKNGRTVTQHLETHRVDLKGSRPKATWASFASTANSSTSSYVSPYRQKPSMAITC 209
            |:||......::|...:...||..:.||.|...........:....:....::.|:::       
Zfish   134 LMKTLSRKKLEQNLTLLQLFLEMEKEDLLGENNLDVLQRIFADIYPALGRKINQYKEE------- 191

  Fly   210 TSPNIKTPKTTSSTSSSSASSITSPPKPSSSVSSISSIFKSAPKQVDK-PLSSTATPKPFISLGS 273
               |:........|  ...|||...|...:|:||:..|    .:::|: .|:..|:       |.
Zfish   192 ---NLNGVFIAQET--EGISSIADLPSAQTSLSSVEMI----DREMDEITLNENAS-------GF 240

  Fly   274 SGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARV--YIFNHER-----FDNKNEF-- 329
            ||            .::|.:.|.:.||...|....:::.:.|  |....||     ..|..:|  
Zfish   241 SG------------DNSQHSDSVNSGIISESSEMPQIENSMVEQYEMKGERRGVCLIINNYDFSA 293

  Fly   330 -----RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGT 389
                 |:|:..|...||..||.|..::....|.|...|.:.:..|.|:|......:|..|||||.
Zfish   294 CGWLNREGTDIDHDSLRDVFEWLGFEILTRRDCTGDQILQALMDLSTQDHTQADCVVCCILSHGR 358

  Fly   390 RHDQIAAKDDDYSLDDDVVFPI---------LRNRTLKDKPKLIFVQACKG-DCQLGGF------ 438
            .:|.|..        |....|.         .|..:|..||||.|:|||:| ..|...|      
Zfish   359 LNDIIGV--------DGKAVPFKELMETLSPFRCSSLYQKPKLFFIQACRGTQNQRAVFPQTFTE 415

  Fly   439 -----MTDAAQPNGSPNEI---LKCYSTYEGFVSFRTED-GTPFIQTLCEALN-RSGKTSDIDTI 493
                 .:||..|..|..|:   |...||...:.|:|.:. ||.|||:||:.|. ...:.:|:.:|
Zfish   416 DEDVLASDAGVPRDSIPEMADYLMAMSTVPWYASYRDKSKGTWFIQSLCDNLRLLVPRGNDLLSI 480

  Fly   494 MMNVRQVVKMQSK----DRQIPSVTSTLTSKYVF 523
            :..|...|..:|.    .:|:|....:||...||
Zfish   481 LTKVNADVSKKSDKSGLKKQMPQPEFSLTRTVVF 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 71/256 (28%)
casp10XP_685430.4 DED_Caspase_8_10_r1 11..87 CDD:260059
DED_Caspase_8_10_r2 108..190 CDD:260042 10/56 (18%)
DUF4603 <200..>256 CDD:292020 19/81 (23%)
CASc 273..515 CDD:237997 71/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.