DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and casp6a

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001018333.1 Gene:casp6a ZFINID:ZDB-GENE-030825-4 Length:298 Species:Danio rerio

Alignment Length:294 Identity:77/295 (26%)
Similarity:123/295 (42%) Gaps:49/295 (17%)


  Fly   273 SSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARVYIFNHER------FDNKNEF-- 329
            |.|....:..:.:..|..:..::.:...::|..:   :.|.:.|..||:|      |:::|.|  
Zfish     7 SDGSAAVEKDSASAGQTVEENLTETDSFNQSIFS---MDPNQEYDMNHKRRGMALIFNHENFFWK 68

  Fly   330 -----RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGT 389
                 |.|:..|.:.|...|.:|..:|:...|.....:...:......|..|...||.|.|||| 
Zfish    69 LGLGYRSGTNADKENLIRRFRELNFEVKAFDDYKRHEVLSKITEAAAADHVDADCLVCVFLSHG- 132

  Fly   390 RHDQIAAKDDDYSLDDDV-VFPILRNRTLKDKPKLIFVQACKGDCQ--------------LGGFM 439
            .:..:.|.|....:.:.. :|...:.|:|..|||:...|||:||..              ....:
Zfish   133 ENGHVYANDGQIEIPEITDLFKGDKCRSLVGKPKIFIWQACRGDKHDDPVTPMDVVDSQVTNDMV 197

  Fly   440 TDA----AQPNGSPNEILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQ 499
            .||    ..|.|:  :.:.|||..||:.|.| |.:|:.:||.|||.|.|.|...:...|:..|.:
Zfish   198 VDAGVLYTLPAGA--DFIMCYSVAEGYYSHRETVNGSWYIQDLCEILRRYGSELEFAEILTLVNR 260

  Fly   500 VVKMQS----KDR------QIPSVTSTLTSKYVF 523
            .|.::|    |||      |:|...|.||.|..|
Zfish   261 KVSLRSVLNCKDRSAVGKKQVPCFASMLTKKLFF 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 72/255 (28%)
casp6aNP_001018333.1 CASc 47..294 CDD:237997 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10454
Phylome 1 0.910 0.885 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.