DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and casp10

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001015715.2 Gene:casp10 XenbaseID:XB-GENE-480459 Length:519 Species:Xenopus tropicalis

Alignment Length:462 Identity:102/463 (22%)
Similarity:171/463 (37%) Gaps:124/463 (27%)


  Fly   157 NGRTVTQHLETHRVDLKGSRPKATWASFASTANSSTSSYVSPYRQKPSMAITCTSPNI------- 214
            |..::.::|.|::..::.:.|:              ...:|||||    .:...|.||       
 Frog    70 NHHSLLRNLGTNKEKVQKALPR--------------HGRISPYRQ----MLYQLSENIAGDDEKR 116

  Fly   215 -----------KTPKTTSST--SSSSASSITSPPKPSSSVSSISSIFKS-AP------------- 252
                       |..||....  .....:|||     ...|..:..|||. ||             
 Frog   117 VYFLLPLQKKHKENKTFLEVLCQLERENSIT-----EDDVELLEDIFKKVAPDLLKIIEKYKERG 176

  Fly   253 ---KQVDKPLSSTATP--------KPFISLGSSG--------GTKP------KVTAVAQSQ-DAQ 291
               .|.:..|...:.|        .|.:|:..|.        ||:.      |:...|:.: |..
 Frog   177 DKLHQTENHLIDPSAPPEDEHELINPPLSIQVSSKDSELWDKGTESLIEHTGKIHEEAEKEDDKS 241

  Fly   292 GTISTSLGISK--SSLTKNKLKPARVYIFNHER------FDN----KNEFRKGSAQDVKVLRATF 344
            |.|:..|...:  |.:|....| ...|..||:.      .||    |...|:||.:|...|...|
 Frog   242 GNINHQLSDLRLNSEMTPQANK-EEFYDMNHKHRGYCLIIDNSVFMKGNRREGSDKDAGALSDVF 305

  Fly   345 EQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDDYSLDDDV-V 408
            ..|..:|::..:.....|:..::..:::|..::...|..||:||.....:.:.|.:.|:.:.: .
 Frog   306 SWLGLEVDIFENLMSEQIRDCLKRFKSRDHSERDCFVCCILTHGESGTVMGSDDKEVSIREIMSY 370

  Fly   409 FPILRNRTLKDKPKLIFVQACKGDCQLGGFM-------TDAAQPNGSPN---------EILKCYS 457
            |..:...:|..||||.|:|||:|.     |.       .||..|..:..         :.|...|
 Frog   371 FTAISCTSLVLKPKLFFIQACQGK-----FTHPSSKVEADAIVPEENKKYVVNVPKDADFLLGMS 430

  Fly   458 TYEGFVSFR-TEDGTPFIQTLCEAL-NRSGKTSDIDTIMMNVRQVVKMQSKD----RQIPSVTST 516
            |.:|:.::| |.:|:.:||.||:.| ....:..||..|:..|.:.|.::...    :|:|..:.|
 Frog   431 TVDGYAAYRHTREGSWYIQALCKNLVELVPRGEDILAILTKVNKDVSLKEGQQGILKQMPQPSYT 495

  Fly   517 LTSKYVF 523
            |..|..|
 Frog   496 LLKKLRF 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 61/245 (25%)
casp10NP_001015715.2 DD 1..82 CDD:301326 3/12 (25%)
DED_Caspase_10_r2 95..174 CDD:260074 20/88 (23%)
CASc 266..503 CDD:237997 61/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.