DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and ZK795.2

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_502403.2 Gene:ZK795.2 WormBaseID:WBGene00014082 Length:292 Species:Caenorhabditis elegans

Alignment Length:161 Identity:36/162 (22%)
Similarity:62/162 (38%) Gaps:39/162 (24%)


  Fly   270 SLGSSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARVYIFNHE-----RFDNKNEF 329
            ||..||..|..|.........|.||.   ||: ..:.|:::|..::::  ||     .|....:.
 Worm    22 SLSGSGAIKMVVMGKDTDVAWQKTID---GIA-LYIAKHQVKSPQIFV--HENGSICEFIGGVDR 80

  Fly   330 RKGSAQDVKVLRA-TFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQ 393
            .|..|..:.|::. |.::|||..|                     :..:|..||.|..:.|    
 Worm    81 SKMRADFILVIKKHTSQKLKCDPE---------------------WGRQSFGVLNIEKYPT---- 120

  Fly   394 IAAKDDDYSLDDDVVFPILRNRTLKDKPKLI 424
            ::..|:|.:....::|.  .:.|...|||.:
 Worm   121 LSQTDEDLAFTAKIIFN--SSETGSAKPKTV 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 24/121 (20%)
ZK795.2NP_502403.2 DUF1510 180..>263 CDD:284770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.