DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Strica and casp8l1

Sequence 1:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001092089.1 Gene:casp8l1 ZFINID:ZDB-GENE-070608-1 Length:330 Species:Danio rerio

Alignment Length:347 Identity:84/348 (24%)
Similarity:140/348 (40%) Gaps:62/348 (18%)


  Fly   210 TSPNIKTPKTTSSTSSSSASSITSPPKPSSSVSSISSIFK-----SAPKQVDKPLSSTAT----- 264
            ::||.......:|.:.........|.:.::|.....::.|     ::||:..:||.||..     
Zfish     5 SNPNNSNQINRASPNEQEKIKTDEPKRKNTSQEDKENLHKGVQNNNSPKRQREPLQSTCNISDHY 69

  Fly   265 PKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARVYIFNHERFDNKN-E 328
            ||             :..||.:.::.....:..||.              ..|.|:.:|::.: .
Zfish    70 PK-------------RKRAVTEQKECYSMSNRPLGY--------------CLIINNYKFESASLA 107

  Fly   329 FRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQ 393
            .|:|:.:|...|...||::..||||..|.....::..::....||....:|.|..||:||.: ..
Zfish   108 DRRGTDRDKDDLTKVFEKMYFKVEVRDDLQASVMRNVIKEFAEKDHSQMNAFVCCILTHGEK-GT 171

  Fly   394 IAAKDDDYSLDDDVVFPILRNRTLKDKPKLIFVQACKGDCQLGGFMTDAAQPNGSPNE------- 451
            :...|.......::..|....|:|..||||.|:|||:|:.:..|......:.|.:..|       
Zfish   172 VLGTDGKQVPIRELSQPFAECRSLASKPKLFFIQACQGNMRQQGLWMAHERENTTEEEAYEEDAH 236

  Fly   452 ------------ILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNRS-GKTSDIDTIMMNVRQVV- 501
                        .|...:|.|...||| .::|:.|||.||:.|.|. .:..||.:|:..|..|| 
Zfish   237 AAGNYSIPMDADFLFAIATVEHCKSFRHIKNGSIFIQELCKQLERGCAQKKDILSILTAVNGVVG 301

  Fly   502 -KMQSKDRQIPSVTSTLTSKYV 522
             |:....:|:|.|..|||...|
Zfish   302 SKILQGYKQMPEVRYTLTKALV 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 66/237 (28%)
casp8l1NP_001092089.1 CASc 82..325 CDD:237997 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.