DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act42A and ARP4A

DIOPT Version :9

Sequence 1:NP_523625.1 Gene:Act42A / 35526 FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001323058.1 Gene:ARP4A / 843728 AraportID:AT1G73910 Length:167 Species:Arabidopsis thaliana


Alignment Length:117 Identity:42/117 - (35%)
Similarity:64/117 - (54%) Gaps:16/117 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG---------------MGQKDS 53
            :||:|:|||.||..||||:||:|||:|||||:||.....|:.:.               .|::..
plant     5 DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGNGMDIDDAANTTEDAKESDKEKGKRKL 69

  Fly    54 YVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 104
            |.|.:|.: :|..:.:..|.:.||||:||.::.:|.|.|.....:...|..|
plant    70 YTGSQALNFRRDQMEILSPTKDGIVTDWDMVDNVWDHAFRASSELTAAERKV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 42/117 (36%)
ARP4ANP_001323058.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.