DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Act42A and Actl9

Sequence 1:NP_523625.1 Gene:Act42A FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_899105.2 Gene:Actl9 MGIID:1916731 Length:415 Species:Mus musculus

Alignment Length:375 Identity:154/376 (41%)
Similarity:241/376 (64%) Gaps:9/376 (2%)


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 68
            :..|:|:|.|:|.||.||||...|.....:|:| :|:.|... ...:.::::|:.|:| |..|.|
Mouse    47 KTGAVVIDMGTGTCKVGFAGQSQPTYTVATILGCQPKKQATK-DQSELETFIGEAARS-RPELRL 109

  Fly    69 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 133
            ..||.:|||.:|:..|.||.|...::|:||..|||:|.::.|.:|..||||:.::.||:.::||:
Mouse   110 VKPIRNGIVVDWEAAELIWRHILEHDLQVATHEHPLLFSDPPFSPATNREKLVEVAFESLHSPAL 174

  Fly   134 YVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198
            |||.|:|||:||.||..|:|:|:|.|||:|||:.:||.|||||.||||||..||.:|.::|...|
Mouse   175 YVASQSVLSVYAHGRVNGLVVDTGHGVSYTVPVVQGYNLPHAIQRLDLAGNHLTAFLAEMLLGSG 239

  Fly   199 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLF 263
            :|. ...:.::|.:||...||:|.||::|.  |......::|.:||||:.:|:|.|.|:|||.||
Mouse   240 FSL-QQEDLDLVENIKHHYCYLAPDFQKEQ--ARPDEECKQSLKLPDGRTVTLGKELFQCPELLF 301

  Fly   264 QPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT-ALAPSTM 326
            .|..: |:...|:......|::|...::|..:..|.:|.||::::.|:..|.:.|:. :|:|.. 
Mouse   302 HPPEIPGLSPIGLPAMAEQSLLKVPQELRPHVARNVILCGGSSLFTGLEGRFRAELLHSLSPED- 365

  Fly   327 KIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
            .:.::|.|.|..||||||||||||..||..|:.:::|:|.||.:|:|||:
Mouse   366 HVVVMAHPNRNLSVWIGGSILASLHAFQSCWVLREQYEERGPQVVYRKCY 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 154/374 (41%)
Actl9NP_899105.2 NBD_sugar-kinase_HSP70_actin 48..415 CDD:302596 154/373 (41%)
ACTIN 48..414 CDD:214592 153/372 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.