DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or42a and Or98b

Sequence 1:NP_523622.2 Gene:Or42a FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster

Alignment Length:250 Identity:53/250 (21%)
Similarity:101/250 (40%) Gaps:54/250 (22%)


  Fly   169 PYQNYYPFLDWRSSTLHLALQAGLEYF----AMAGACFQDVCVDCYPVNFVLVLRAHMSIFAERL 229
            |:.:.||   |.:..|...:   :.||    |..|.....||||..   |..:.....::|....
  Fly   162 PFPSVYP---WDNMKLSNYI---ISYFWNVCAALGVALPTVCVDTL---FCSLSHNLCALFQIAR 217

  Fly   230 RRLGTYPYESQEQKYERLVQCIQDHKVILRFVDCL----RPVISGTIFVQFLVVGL---VLGFTL 287
            .::..:...:.::.:|.|....|.:.:.|.....|    ||:|     .||:...|   ||.:.|
  Fly   218 HKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRPLI-----CQFVAASLHLCVLCYQL 277

  Fly   288 -INIVLFANLGSAIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLM 351
             .||:..|.|..|    :|.|||:.:.:.:|...:.:..:|.....|:::|:|           .
  Fly   278 SANILQPALLFYA----AFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSW-----------P 327

  Fly   352 YFLQKLQQPITFMAMNVFPISVG-------------TNISVTKFSFSVFTLVKQM 393
            :.||:..|.::.:.:.:...|:|             |.|::.:.:.|..||::.:
  Fly   328 HLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEANRETLITIVRTAISYVTLLRSL 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 50/240 (21%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 50/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.