DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or42a and Or83a

Sequence 1:NP_523622.2 Gene:Or42a FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster

Alignment Length:490 Identity:106/491 (22%)
Similarity:187/491 (38%) Gaps:154/491 (31%)


  Fly    15 KDSPVRSRDATLYLLR--CVFLMGVRKPPAKFFV--AYVLWSFALNFCSTFYQPIGFLTGYIS-H 74
            ||...| ||..:::.:  |:..|    .|..::|  :.|| :..:.||...|:...:   ::| |
  Fly    11 KDDSKR-RDLFVFVRQTMCIAAM----YPFGYYVNGSGVL-AVLVRFCDLTYELFNY---FVSVH 66

  Fly    75 LSEFSPGEFLTSLQVAFNAW------SCSTKVLI-VWALV-----KRFDEA------NNLLDEMD 121
            ::    |.::.::.:.:...      :|..:.:| :|.:.     :||...      :|:.||.:
  Fly    67 IA----GLYICTIYINYGQGDLDFFVNCLIQTIIYLWTIAMKLYFRRFRPGLLNTILSNINDEYE 127

  Fly   122 RRITDPGERLQIHRAVSLSNRIFFFFMA-------------VYMVYATNTFLSAIFIG----RPP 169
            .|           .||..|    |..||             ||..|....|..|:.|.    ..|
  Fly   128 TR-----------SAVGFS----FVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSLP 177

  Fly   170 YQNYYPFLDWRSSTLH---LALQAGLEY-----FAMAGACFQDVCV---DCYPVNF--------- 214
            ...:||| |:....::   ..|||..:.     ||.:......:||   ..|.|.|         
  Fly   178 LACWYPF-DYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLAS 241

  Fly   215 -VLVLRAHMSIFAERLRRL-----------GTYPYESQEQK--YERL----------------VQ 249
             .:::.|:|:    .|.:|           |.|.|..:|:.  .|.|                |:
  Fly   242 SYVLMGANMT----ELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVR 302

  Fly   250 CIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGSAIAALSFM-------- 306
            |||.|:.|   |..|:.:.|....:.|:.:|.|.  .|:.:|.|.:..|. ||.|||        
  Fly   303 CIQHHRYI---VAALKKIESFYSPIWFVKIGEVT--FLMCLVAFVSTKST-AANSFMRMVSLGQY 361

  Fly   307 -AAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQPITFMAMNVFP 370
             ..||.|....|...:.:.::..:..:||::|.|....|..:...|:|:...::.        |.
  Fly   362 LLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQ--------FQ 418

  Fly   371 ISVG--TNISVTKF------SFSVFTLVKQMNISE 397
            ::.|  :|::|.:|      :||..||:::|:..|
  Fly   419 LTAGKISNLNVDRFRGTITTAFSFLTLLQKMDARE 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 84/407 (21%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 67/304 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.