DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or74a

DIOPT Version :8

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster

Alignment Length:435 Identity:87/436 (20%)
Similarity:153/436 (35%) Gaps:140/436 (32%)


  Fly    25 TLYLLRCVFLMGVRKPPAKFFVAYVLWSFALNFCS----TFYQPI-------GFLTGYISHLSEF 78
            |::|.|.:..:|       |.|          ||.    .|:..|       ..|||..::|   
  Fly    43 TVFLDRLMIFLG-------FLV----------FCEHNEVDFHYLIANRQDMDNMLTGLPTYL--- 87

  Fly    79 SPGEFLTSLQVAFNAWSCSTKVLIVW------ALVKRFDEANNLLDEMDRRITDPGERLQIHRAV 137
                .|..:|:     .|   ..:.|      ||::||.....:.:||:..:....:|..:...|
  Fly    88 ----ILVEMQI-----RC---FQLAWHKDRFRALLQRFYAEIYVSEEMEPHLFASIQRQMLATRV 140

  Fly   138 SLSNRIFFFFMAVYMVYATNTFL----SAIFIGRPP-YQNYYPFLDWRSSTLHLALQAGLEYFAM 197
            :         ..||::...|.||    :.|:..|.. |:..|||   .::.||.           
  Fly   141 N---------STVYLLALLNFFLVPVTNVIYHRREMLYKQVYPF---DNTQLHF----------- 182

  Fly   198 AGACFQDVCVDCYPVNFVL--VLRAHMSIFAERLRRLGTYPYESQEQKYERLVQCIQD----HKV 256
                |..:.|..:.|.|::  :|...:::..|.:..|..           |.:|..||    .::
  Fly   183 ----FIPLLVLNFWVGFIITSMLFGELNVMGELMMHLNA-----------RYIQLGQDLRRSAQM 232

  Fly   257 ILRFVDCLRPVISG---------------------------TIFVQF-LVVGLVL-----GFT-- 286
            :|:....|...|:.                           .|||.| ...||:.     .||  
  Fly   233 LLKKSSSLNVAIAYRLNLTHILRRNAALRDFGQRVEKEFTLRIFVMFAFSAGLLCALFFKAFTNP 297

  Fly   287 ---LINIVLFANLGSAIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQK 348
               :..||.|......:.||..:.::||:||....:. |.|.|..::   :.||:.:.|..:..|
  Fly   298 WGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMM-YYTADWEQV---IHQSDNVGENVKLMK 358

  Fly   349 TLMYFLQKLQQPITFMAMNVFPISVGTNISVTKFSFSVFTLVKQM 393
            .:...:|...:|.....:|.|.:|:...:.:.:.:||.||.:..|
  Fly   359 LVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSM 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 68/360 (19%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 72/376 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51051
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.