DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or42a and Or67d

Sequence 1:NP_523622.2 Gene:Or42a FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster

Alignment Length:405 Identity:89/406 (22%)
Similarity:158/406 (39%) Gaps:51/406 (13%)


  Fly    14 SKDSPVRSRDATLYLLR-CVFLMG--VRKPPAKFFVAYVLW-SFALNFCSTFYQPIGFLTGYISH 74
            :|..||......:.::| ||...|  |..|..:.:     | ::|:.....|:..   .|||..:
  Fly     5 AKVEPVERYCKVIRMIRFCVGFCGNDVADPNFRMW-----WLTYAVMAAIAFFFA---CTGYTIY 61

  Fly    75 LSEFSPGE---FLTSLQVAFNAWSCSTKVLIVWALVKRFDEANNLLDEMDRRITDPGERLQ--IH 134
            :.....|:   .|.:|.:..:|....||:|:.........|..|..:::.|.....|:...  :.
  Fly    62 VGVVINGDLTIILQALAMVGSAVQGLTKLLVTANNASHMREVQNTYEDIYREYGSKGDEYAKCLE 126

  Fly   135 RAVSLSNRIFFFFMAVYMVYATNTFLSAIFIGRPPY------------QNYYPFLDWRSSTLHLA 187
            :.:.::..:...||.||::      |..:.|..|.:            |...||||..:...||.
  Fly   127 KRIRITWTLLIGFMLVYII------LLGLVITFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLI 185

  Fly   188 LQAGLEYFAMAGACFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLGTYPYESQEQKYERLVQC-- 250
            |.|........|. |.:...|.|...||..:.....||..:|........:..:....|.:.|  
  Fly   186 LTAAHVILITFGG-FGNYGGDMYLFLFVTHVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDL 249

  Fly   251 IQDHKVILRFVDCLRPVISGTIFVQF--LVVGLVLGFTLINIVLFANLGSAIAALSFMAAVLLET 313
            :..|::..|.:...:.:.|..:|||.  ..|||:...:.|    |.....|.......||:.|.|
  Fly   250 LVWHQLYTRMLQTTKKIYSIVLFVQLSTTCVGLLCTISCI----FMKAWPAAPLYLLYAAITLYT 310

  Fly   314 TPFCILCNYLTEDCYKLADALFQSN--WIDEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTN 376
              ||.| ..|.|:..:...::..:|  |.:...:.:|.::..|.|.|..:...|.::.|:|:.|.
  Fly   311 --FCGL-GTLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTA 372

  Fly   377 ISVTK--FSFSVFTL 389
            :.:||  :|||:..:
  Fly   373 LQLTKGIYSFSMMLM 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 72/330 (22%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 70/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50478
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.