DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or42a and Or47a

Sequence 1:NP_523622.2 Gene:Or42a FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523689.1 Gene:Or47a FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster

Alignment Length:251 Identity:53/252 (21%)
Similarity:94/252 (37%) Gaps:42/252 (17%)


  Fly   116 LLDEMDRRITDPGERLQ-----IHRAVSLSNRIFFFFMAVYMV-YATNTFLSAIFIG-------- 166
            |:|:....:::..|:.:     ::.|.....|:...|...::: :|.|:.|..:.:|        
  Fly    90 LIDKFRLLMSNEAEQGEEYAEILNAANKQDQRMCTLFRTCFLLAWALNSVLPLVRMGLSYWLAGH 154

  Fly   167 -RP--PYQNYYPFLDWRSSTLHLALQAGLEY----FAMAGACFQDVCVDCYPVNFVLVLRAHMSI 224
             .|  |:...:|   |   .:|:.....|.:    ||..|.....|.:|....:|...|.|...|
  Fly   155 AEPELPFPCLFP---W---NIHIIRNYVLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLCAFFKI 213

  Fly   225 FAERLRRL-GTYPYESQE--QKYERLVQCIQDHKVILRFVDCLRPVISGTIFV---QFLVVGLVL 283
            ...::.|. |....|||.  .|...|.|...|....|.  .|.:|:|....|:   |..::|.:.
  Fly   214 AQYKVVRFKGGSLKESQATLNKVFALYQTSLDMCNDLN--QCYQPIICAQFFISSLQLCMLGYLF 276

  Fly   284 GFTLINIVLFANLGSAIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNW 339
            ..|      ||.......| ||:|.::::...:|.....|..:......|::.|.|
  Fly   277 SIT------FAQTEGVYYA-SFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPW 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 53/252 (21%)
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 53/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.