DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or42a and Or65c

Sequence 1:NP_523622.2 Gene:Or42a FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster

Alignment Length:404 Identity:80/405 (20%)
Similarity:148/405 (37%) Gaps:107/405 (26%)


  Fly    10 LYTQSKD--SPVRSRDATLYLLR---CVFLM--GVR-----KPPAKFFVAYVLWSFALNFCSTFY 62
            |||.||:  .|.||...||.:::   |...|  ||.     |......:|:::..|.:.|...::
  Fly    45 LYTTSKERQMPYRSSWHTLVIIQATVCFLTMCYGVTESLGDKVQMGRDIAFIIGFFYIAFKIYYF 109

  Fly    63 QPIGFLTGYISHLSEFSPGEFLTSLQVAFNAWSCSTKVLIVWALVKRFDEANNLLDEMDRRITDP 127
            |..|         .|..  |.:.:|: .|:.|:......:.:...||                  
  Fly   110 QWYG---------DELD--EVVEALE-TFHPWAQKGPGAVDYRTAKR------------------ 144

  Fly   128 GERLQIHRAVSLSNRIFFFFMAVYMVYATNTFLS---AIFIGRP--------PYQNYYPFLDWRS 181
                            ::|.:|.::..:...||.   .:.|..|        |....:|| .|..
  Fly   145 ----------------WYFTLAFFLASSWLVFLCIFILLLITSPLWVHQQILPLHAAFPF-QWHE 192

  Fly   182 STLHLALQA--------GLEYFAMAGACFQDVCVDCY-PVNFVLVLRAHMSIFAERLRRL--GTY 235
            .::|....|        .:.||.....|.:.:.|..| .:.|.:      .:....||.|  ..:
  Fly   193 KSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAI------EVLCLELRHLHQRCH 251

  Fly   236 PYESQEQKYERLVQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINI-VLFA----- 294
            .||....:..||||.   |:.|:..:|....|..||:.:|     :.:.|.|::: ||.|     
  Fly   252 GYEQLRLETNRLVQF---HQKIVHILDHTNKVFHGTLIMQ-----MGVNFFLVSLSVLEAMEARK 308

  Fly   295 --NLGSAIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQS-NWIDEEKRYQKTLMYFLQK 356
              .:.:..|.|..:|  |...:.:....:.|::....:::|.::: :.|...|...:.|...:::
  Fly   309 DPKVVAQFAVLMLLA--LGHLSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLIIRR 371

  Fly   357 LQQPITFMAMNVFP 370
            .|:|: .|..:.||
  Fly   372 GQEPL-IMRASPFP 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 59/324 (18%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 65/363 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51657
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.