DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or42a and Or65b

Sequence 1:NP_523622.2 Gene:Or42a FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster

Alignment Length:410 Identity:82/411 (20%)
Similarity:157/411 (38%) Gaps:119/411 (29%)


  Fly    10 LYTQSKDS--PVRSRDATLYLLRCVFLMGVRKPPAKFFVAYVLWSFALNFCSTFYQPIGFLTGYI 72
            |:|.:::.  |.||:..||..::.|.          ||.:   .||.|.      :.:|      
  Fly    41 LFTTTEERLLPYRSKWHTLVYIQMVI----------FFAS---MSFGLT------ESMG------ 80

  Fly    73 SHLS-----EFSPGEFLTSLQVAFNAWSCSTKVLIVWALVKRFDEANNLLDEMDRRITD-----P 127
            .|:.     .|..|.|....:..:..|                     ..||:|:.|:|     |
  Fly    81 DHVQMGRDLAFILGAFFIIFKTYYFCW---------------------YGDELDQVISDLDALHP 124

  Fly   128 GERLQIHRAVSLSNRIFFFFMAVYMVYATNTFLS---AIFIGRP--------PYQNYYPFLDWRS 181
            ..:...:.....:.:.::|.||.::..:.:.||.   .:.|..|        |:...:|| .|..
  Fly   125 WAQKGPNPVEYQTGKRWYFVMAFFLATSWSFFLCILLLLLITSPMWVHQQNLPFHAAFPF-QWHE 188

  Fly   182 STLHLALQAGL----EYFAMAGACFQDVCVDCYPVNFVLVLRA-HMSIFAE----------RLRR 231
            .:||....|.:    .|||:            |.:.::|.:.. .:.|:||          .||:
  Fly   189 KSLHPISHAIIYLFQSYFAV------------YCLTWLLCIEGLSICIYAEITFGIEVLCLELRQ 241

  Fly   232 LGTYPYESQEQKYE--RLVQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINI-VLF 293
            :..:.|..||.:.|  |||:.   |:.|:..:|....|..||:.:|     :.:.|:|::: ||.
  Fly   242 IHRHNYGLQELRMETNRLVKL---HQKIVEILDRTNDVFHGTLIMQ-----MGVNFSLVSLSVLE 298

  Fly   294 A-------NLGSAIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQS-NWIDEEKRYQKTL 350
            |       .:.:..|.|..:|...|....:|  .:.|::...::::|.::: :.....|...:.|
  Fly   299 AVEARKDPKVVAQFAVLMLLALGHLSMWSYC--GDQLSQKSLQISEAAYEAYDPTKGSKDVYRDL 361

  Fly   351 MYFLQKLQQPITFMAMNVFP 370
            ...:::.|.|: .|..:.||
  Fly   362 CVIIRRGQDPL-IMRASPFP 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 66/335 (20%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 67/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51648
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.