DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or42a and Or7a

Sequence 1:NP_523622.2 Gene:Or42a FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_511081.1 Gene:Or7a FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster

Alignment Length:415 Identity:143/416 (34%)
Similarity:222/416 (53%) Gaps:37/416 (9%)


  Fly    14 SKDSPVRSRDATLYLLRCVFLMGVRKPP--------------AKFFVAYVLWSFALNFCSTFYQP 64
            :|.....||.|...|..|.:.:|::.|.              |.|.|...:|...|       .|
  Fly     9 TKQEVPESRRAFRNLFNCFYALGMQAPDGSRPTTSSTWQRIYACFSVVMYVWQLLL-------VP 66

  Fly    65 IGFLTGYISHLSEFSPGEFLTSLQVAFNAWSCSTKVL-IVW--ALVKRFDEANNLLDEMDRRITD 126
            ..|:..| .::......:.|||.|||.:|.....|:: :.|  .|::|   |.:.|..:|.|..:
  Fly    67 TFFVISY-RYMGGMEITQVLTSAQVAIDAVILPAKIVALAWNLPLLRR---AEHHLAALDARCRE 127

  Fly   127 PGERLQIHRAVSLSNRIFFFFMAVYMVYATNTFLSAIFIGRPPYQNYYPFLDWRSSTLHLALQAG 191
            ..|...|..||...|.:.:|:...|.:|:::||:.|..:|:|||..|.|.|||:.|.:...:||.
  Fly   128 QEEFQLILDAVRFCNYLVWFYQICYAIYSSSTFVCAFLLGQPPYALYLPGLDWQRSQMQFCIQAW 192

  Fly   192 LEYFAMAGACFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLGT--------YPYE-SQEQKYERL 247
            :|:..|...|......|.|.|.::.|:|..:.:.|.|:.:|||        ||.| .||:....|
  Fly   193 IEFLIMNWTCLHQASDDVYAVIYLYVVRIQVQLLARRVEKLGTDDSGQVEIYPDERRQEEHCAEL 257

  Fly   248 VQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGSAIAALSFMAAVLLE 312
            .:||.||:.:|:.:||:.||||.|||||||:...::|.|:|||.:|||..:.||::.::.||.|:
  Fly   258 QRCIVDHQTMLQLLDCISPVISRTIFVQFLITAAIMGTTMINIFIFANTNTKIASIIYLLAVTLQ 322

  Fly   313 TTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNI 377
            |.|.|.....|..|..:||.|:||..|:.:..|::|.|:|:|.:.|||||..||.:|||::.|..
  Fly   323 TAPCCYQATSLMLDNERLALAIFQCQWLGQSARFRKMLLYYLHRAQQPITLTAMKLFPINLATYF 387

  Fly   378 SVTKFSFSVFTLVKQMNISEKLAKS 402
            |:.|||||::||:|.||:.|:..::
  Fly   388 SIAKFSFSLYTLIKGMNLGERFNRT 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 119/317 (38%)
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 119/317 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5162840
eggNOG 1 0.900 E1_2C9X1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.