DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cndp2 and AT4G38225

DIOPT Version :10

Sequence 1:NP_610181.2 Gene:Cndp2 / 35507 FlyBaseID:FBgn0287767 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_974705.1 Gene:AT4G38225 / 829979 AraportID:AT4G38225 Length:365 Species:Arabidopsis thaliana


Alignment Length:31 Identity:7/31 - (22%)
Similarity:14/31 - (45%) Gaps:1/31 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VDGKKEDYIGALKTVVGIQSVSAWPEKRGEI 45
            :.|.|...:....:|.| ..|:.||.:..::
plant   163 IGGGKSSALAFSYSVTG-SYVAVWPLRNNQL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cndp2NP_610181.2 M20_dipept_like_CNDP 11..478 CDD:349925 7/31 (23%)
AT4G38225NP_974705.1 None

Return to query results.
Submit another query.