DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kune and sinu

DIOPT Version :8

Sequence 1:NP_610179.2 Gene:kune / 35504 FlyBaseID:FBgn0033032 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_647971.3 Gene:sinu / 46187 FlyBaseID:FBgn0010894 Length:247 Species:Drosophila melanogaster

Alignment Length:193 Identity:76/193 - (39%)
Similarity:101/193 - (52%) Gaps:11/193 - (5%)


  Fly    16 VFSLICFVIAFSTPYWLVTDGRLQNPRFTNLGLWEVCFNNFQDIHRFFDNS----FNGCLWV--- 73
            ||:....||||:||.|||:|.|:...:...||||..||.:..|::   |:|    |.||.||   
  Fly    44 VFAFAFIVIAFATPSWLVSDYRITGAKLDRLGLWVHCFRSLPDVN---DDSQRRFFVGCRWVYDP 105

  Fly    74 FEEEYYIIHDFLLPGFYISVQLFATLCFVMCLV-VIPLTVAFLRTSRDDDRYMVLLLAIGSCQVV 137
            |...|..|..||||.|.|:.|.|.||.|:..|| .|.:.|..|....|...::.|:.::|...:.
  Fly   106 FTTGYDEIRGFLLPAFMIATQFFYTLAFIGMLVSAIGVLVFILCAGPDQKHFITLIKSLGYVLLG 170

  Fly   138 GSVFGFIAVVIFGAKGDSRDWMPGWQNNDMGWSFALGVVGAVLLLPSGVLYLVEARRERYKRL 200
            ..|...|||::|...|:...|||...||..||||.|..||.||.|.:..|:|.||..:..||:
  Fly   171 AGVSAAIAVIVFAGFGNRNGWMPEHANNWFGWSFILACVGTVLTLVASTLFLSEAHVQHKKRI 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kuneNP_610179.2 Claudin_2 16..190 CDD:290614 71/181 (39%)
sinuNP_647971.3 Claudin_2 44..223 CDD:290614 71/181 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131192909
eggNOG 1 0.900 E1_2CKEE
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21284
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.