DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kune and sinu

DIOPT Version :9

Sequence 1:NP_610179.2 Gene:kune / 35504 FlyBaseID:FBgn0033032 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_647971.3 Gene:sinu / 46187 FlyBaseID:FBgn0010894 Length:247 Species:Drosophila melanogaster


Alignment Length:193 Identity:76/193 - (39%)
Similarity:101/193 - (52%) Gaps:11/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFSLICFVIAFSTPYWLVTDGRLQNPRFTNLGLWEVCFNNFQDIHRFFDNS----FNGCLWV--- 73
            ||:....||||:||.|||:|.|:...:...||||..||.:..|::   |:|    |.||.||   
  Fly    44 VFAFAFIVIAFATPSWLVSDYRITGAKLDRLGLWVHCFRSLPDVN---DDSQRRFFVGCRWVYDP 105

  Fly    74 FEEEYYIIHDFLLPGFYISVQLFATLCFVMCLV-VIPLTVAFLRTSRDDDRYMVLLLAIGSCQVV 137
            |...|..|..||||.|.|:.|.|.||.|:..|| .|.:.|..|....|...::.|:.::|...:.
  Fly   106 FTTGYDEIRGFLLPAFMIATQFFYTLAFIGMLVSAIGVLVFILCAGPDQKHFITLIKSLGYVLLG 170

  Fly   138 GSVFGFIAVVIFGAKGDSRDWMPGWQNNDMGWSFALGVVGAVLLLPSGVLYLVEARRERYKRL 200
            ..|...|||::|...|:...|||...||..||||.|..||.||.|.:..|:|.||..:..||:
  Fly   171 AGVSAAIAVIVFAGFGNRNGWMPEHANNWFGWSFILACVGTVLTLVASTLFLSEAHVQHKKRI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kuneNP_610179.2 Claudin_2 16..190 CDD:290614 71/181 (39%)
sinuNP_647971.3 Claudin_2 44..223 CDD:372799 71/181 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115257at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21284
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.