DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kune and Cldnd1

DIOPT Version :8

Sequence 1:NP_610179.2 Gene:kune / 35504 FlyBaseID:FBgn0033032 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001239379.1 Gene:Cldnd1 / 224250 MGIID:2447860 Length:276 Species:Mus musculus

Alignment Length:256 Identity:57/256 - (22%)
Similarity:86/256 - (33%) Gaps:81/256 - (31%)


  Fly     5 NRILQVALCASVFSLICFV---IAFSTPYWLVTDGRLQ-NPRFTN-------------------- 45
            ||.....:.|.|.|||..:   .:..|.:|......:| |...:|                    
Mouse    26 NRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDV 90

  Fly    46 -------LGLWEVCFNNFQDIHRF--------FDNSFNGCLWV-----FEEEY------------ 78
                   ||||..|....::.|.:        || ....|:..     |.|:|            
Mouse    91 LFRYNGSLGLWRRCITIPKNTHWYAPPERTESFD-VVTKCMSFTLNEQFMEKYVDPGNHNSGIDL 154

  Fly    79 ---YIIH-DFLLPGFYISVQLFAT---LCFVMCLVVIPLTVAFLRTSRDDDRYMVLLLAIGSCQV 136
               |:.. .||||...:.:..|..   ||..:|..:.|.    |.|.       :|.|..|.| .
Mouse   155 LRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPT----LATG-------ILHLLAGLC-T 207

  Fly   137 VGSVFGFIA-VVIFGAKGDSRDWMPGWQNNDMGWSFALGVVGAVLLLPSGVLYLVEARRER 196
            :|||..::| :.:...|.:    :|...:.:.||||.|..|.|.|...:..|::..|...|
Mouse   208 LGSVSCYVAGIELLHQKVE----LPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNR 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kuneNP_610179.2 Claudin_2 16..190 CDD:290614 52/237 (22%)
Cldnd1NP_001239379.1 PMP22_Claudin 40..257 CDD:304458 50/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003948
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.