DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and AT5G66720

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_201473.1 Gene:AT5G66720 / 836805 AraportID:AT5G66720 Length:414 Species:Arabidopsis thaliana


Alignment Length:366 Identity:71/366 - (19%)
Similarity:120/366 - (32%) Gaps:116/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 KNAALKDDSVNDQNEGSN---GTDFKHTLVSSSNKKLFATG-SNDMTELNQSSKNEFTNSSTSKE 311
            ||..:...||.|..|.|.   ||..|.  |.:|....|:.| :::::.||..|:.....::||.:
plant   104 KNRLVCHYSVVDPLEKSRALFGTLSKS--VHTSPMACFSVGPAHELSSLNGGSQESPPTTTTSLK 166

  Fly   312 FERNINSSQDDEFTDDDADYEENDNVKSPDTSSAESSD----CTENDDDGDEDGNEDSDEEETDE 372
            ..|.::.|               ..:..|:..:....|    |.|....|..||.....|...:.
plant   167 SLRLVSGS---------------CYLPHPEKEATGGEDAHFICDEEQAIGVADGVGGWAEVGVNA 216

  Fly   373 DQMAND--NFCANMIEEPGKDS-------------------GCTAVVCLLQGRDLYVANAGDSRC 416
            ...:.:  ::..:.|:|..|.|                   ..||.:.:|:.:.|:..|.|||..
plant   217 GLFSRELMSYSVSAIQEQHKGSSIDPLVVLEKAHSQTKAKGSSTACIIVLKDKGLHAINLGDSGF 281

  Fly   417 VISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRAL--GDHAYKTNVTLPAE 479
            .:.|.|..:..|    |....                    |.|.:..|  |:.|     .:|:.
plant   282 TVVREGTTVFQS----PVQQH--------------------GFNFTYQLESGNSA-----DVPSS 317

  Fly   480 EQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEE---------------------VVEFVRC 523
            .|:.:        |.....:.:|...||:::.:.:||                     :.|..|.
plant   318 GQVFT--------IDVQSGDVIVAGTDGVYDNLYNEEITGVVVSSVRAGLDPKGTAQKIAELARQ 374

  Fly   524 RLKDNKKLSTICEELFDNCLAPNTMG---DGTGCDNMTAVI 561
            |..|.|:.|..       ..|....|   .|...|::|||:
plant   375 RAVDKKRQSPF-------ATAAQEAGYRYYGGKLDDITAVV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 42/235 (18%)
AT5G66720NP_201473.1 PP2Cc 187..408 CDD:412173 48/264 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.