DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and AT5G06750

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001119181.1 Gene:AT5G06750 / 830564 AraportID:AT5G06750 Length:393 Species:Arabidopsis thaliana


Alignment Length:407 Identity:81/407 - (19%)
Similarity:141/407 - (34%) Gaps:144/407 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 KDDSVNDQNEGSNGTDFKHTLVSSSNKKLFATGSNDMTELNQSSKNEFTNSSTSKEFERNINSSQ 320
            :||..:|.::|.:         |||...|..:     .||.:.|..:|           :|...|
plant    24 RDDDDDDDHDGDS---------SSSGDSLLWS-----RELERHSFGDF-----------SIAVVQ 63

  Fly   321 DDEFTDDDADYEENDNVKSPDTSSAESSDCTENDDDGDEDGNEDSDEEETDEDQMANDNFCANMI 385
            .:|..:|.:..|         |.:........:...|.|.....||...:...:::.:..|.:  
plant    64 ANEVIEDHSQVE---------TGNGAVFVGVYDGHGGPEASRYISDHLFSHLMRVSRERSCIS-- 117

  Fly   386 EE------PGKDSGCTAVV---------------CLLQG----RDLYVANAGDSRCVISRSGQ-- 423
            ||      ...:.|...:|               |.|.|    ..|.:||.||||.|:...|.  
plant   118 EEALRAAFSATEEGFLTLVRRTCGLKPLIAAVGSCCLVGVIWKGTLLIANVGDSRAVLGSMGSNN 182

  Fly   424 -------AIEMSIDHK--------------PEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGD 467
                   |.:::.||.              |:|....  ::|.|     ..|:.|.:.:||::||
plant   183 NRSNKIVAEQLTSDHNAALEEVRQELRSLHPDDSHIV--VLKHG-----VWRIKGIIQVSRSIGD 240

  Fly   468 HAY------KTNVTLP----AEE---QMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVE 519
             ||      ..:.:.|    |||   .::||.|.:...::...|:|::.|.||:|..|::::.||
plant   241 -AYLKRPEFSLDPSFPRFHLAEELQRPVLSAEPCVYTRVLQTSDKFVIFASDGLWEQMTNQQAVE 304

  Fly   520 FV------------------------RCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAV 560
            .|                        .....|.||:.......|.              |::|.|
plant   305 IVNKHPRPGIARRLVRRAITIAAKKREMNYDDLKKVERGVRRFFH--------------DDITVV 355

  Fly   561 IVQFKKKLQELQ-STIP 576
            ::....:|..:: :|:|
plant   356 VIFIDNELLMVEKATVP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 56/274 (20%)
AT5G06750NP_001119181.1 PP2Cc 63..359 CDD:238083 65/328 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.