DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and AT4G33920

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_195118.1 Gene:AT4G33920 / 829536 AraportID:AT4G33920 Length:380 Species:Arabidopsis thaliana


Alignment Length:299 Identity:71/299 - (23%)
Similarity:114/299 - (38%) Gaps:93/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 EETDEDQMANDNFCANMIEE--PGKDSGCTAVVCLLQGR----DLYVANAGDSRCVI-------- 418
            :||:|:      || .|::.  |.|....|...|.|.|.    .|||||.||||.|:        
plant   105 KETEEE------FC-GMVKRSLPMKPQMATVGSCCLVGAISNDTLYVANLGDSRAVLGSVVSGVD 162

  Fly   419 SRSGQAIE-MSIDHKPEDDEEASRIIKA----GGRVTL----DGRVNGGLNLSRALGD------H 468
            |..|...| :|.||... .||..:.:||    ..::.|    ..|:.|.:.:||::||      .
plant   163 SNKGAVAERLSTDHNVA-VEEVRKEVKALNPDDSQIVLYTRGVWRIKGIIQVSRSIGDVYLKKPE 226

  Fly   469 AYKTNV------TLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFV------ 521
            .|:..:      .:|.....::|.|.|....:.|:|.|::.|.||:|.::|.|..||.|      
plant   227 YYRDPIFQRHGNPIPLRRPAMTAEPSIIVRKLKPQDLFLIFASDGLWEHLSDETAVEIVLKHPRT 291

  Fly   522 ------------------RCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFKKKL 568
                              ..|..|.||::......|.              |:::.::|...:. 
plant   292 GIARRLVRAALEEAAKKREMRYGDIKKIAKGIRRHFH--------------DDISVIVVYLDQN- 341

  Fly   569 QELQSTIPPNQTEDKLLK----TSENVSHSLNDQSASKR 603
                   ..:.:..||:|    |:....:||:...|.:|
plant   342 -------KTSSSNSKLVKQGGITAPPDIYSLHSDEAEQR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 60/248 (24%)
AT4G33920NP_195118.1 PP2Cc 42..338 CDD:238083 63/254 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.