DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and AT3G55050

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_191065.2 Gene:AT3G55050 / 824671 AraportID:AT3G55050 Length:384 Species:Arabidopsis thaliana


Alignment Length:303 Identity:70/303 - (23%)
Similarity:114/303 - (37%) Gaps:101/303 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 MANDNFCANMIEEPGKDS------GCTAVVCLLQGRDLYVANAGDSRCVISRSG------QAIEM 427
            :|.:.....:::|..|..      |...:|.::....||||||||||.|:.:..      :|:::
plant   128 VATEEEFLGLVQEQWKTKPQIASVGACCLVGIVCNGLLYVANAGDSRVVLGKVANPFKELKAVQL 192

  Fly   428 SIDHKP--EDDEEASRIIKAG--GRVTLD---GRVNGGLNLSRALGDHAY-------------KT 472
            |.:|..  |...|..|::...  ..|.|.   .||.|.:.:||::|| ||             |.
plant   193 STEHNASIESVREELRLLHPDDPNIVVLKHKVWRVKGIIQVSRSIGD-AYLKRAEFNQEPLLPKF 256

  Fly   473 NVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKKLSTICEE 537
            .|....|:.::.|.|.|....|.|||:|::.|.||:|.::|::|.|:.|                
plant   257 RVPERFEKPIMRAEPTITVHKIHPEDQFLIFASDGLWEHLSNQEAVDIV---------------- 305

  Fly   538 LFDNCLAPNTMGDGTGCDNMTAVIVQFKKKLQELQSTIPPNQTEDKLLKTSENVSHSLNDQSASK 602
              ::|                                 |.|....||:|.:.        |.|:|
plant   306 --NSC---------------------------------PRNGVARKLVKAAL--------QEAAK 327

  Fly   603 RCASQNADADDEILEKNNSKRLKTD-------LEQENIKDRTP 638
            :...:.:|.  |.:|:...:....|       |...|...|||
plant   328 KREMRYSDL--EKIERGIRRHFHDDITVIVVFLHATNFATRTP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 53/220 (24%)
AT3G55050NP_191065.2 PP2Cc 51..358 CDD:238083 65/291 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.