| Sequence 1: | NP_610169.1 | Gene: | CG10417 / 35492 | FlyBaseID: | FBgn0033021 | Length: | 662 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001007379.1 | Gene: | pptc7a / 492506 | ZFINID: | ZDB-GENE-041114-74 | Length: | 297 | Species: | Danio rerio |
| Alignment Length: | 197 | Identity: | 43/197 - (21%) |
|---|---|---|---|
| Similarity: | 68/197 - (34%) | Gaps: | 68/197 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 383 NMIEEPGKDSGCTAVVCLLQGRDLYVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGG 447
Fly 448 RVTLDGRVNGGLNLSRALGDHAYKTNVTL-----PAEEQMISALPD----------IKKLIITPE 497
Fly 498 DEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKKLST------ICEELFDNCLAPNTMGDGT--GC 554
Fly 555 DN 556 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10417 | NP_610169.1 | PP2Cc | 18..>100 | CDD:214625 | |
| PP2Cc | <374..564 | CDD:238083 | 43/197 (22%) | ||
| pptc7a | NP_001007379.1 | PP2Cc | 53..289 | CDD:381813 | 43/197 (22%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||