DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and AT2G05050

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001154495.1 Gene:AT2G05050 / 3767735 AraportID:AT2G05050 Length:193 Species:Arabidopsis thaliana


Alignment Length:111 Identity:32/111 - (28%)
Similarity:53/111 - (47%) Gaps:20/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 KPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITP 496
            ||.:|    .:|    |.|| .|:.|.|.:.|.:||...|         :.:.|.|:.|...:..
plant    79 KPRED----MLI----RFTL-WRIQGSLVVPRGIGDAQLK---------KWVIAEPETKISRVEH 125

  Fly   497 EDEFMVLACDGIWNYMSSEEVVEFVR--CRLKDNKKLSTICEELFD 540
            :.||::||..|:|:.:|::|.|:..|  |...:...|...|::|.|
plant   126 DHEFLILASHGLWDKVSNQEAVDIARPFCLRTEKPLLLAACKKLVD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 32/111 (29%)
AT2G05050NP_001154495.1 PP2Cc 1..189 CDD:238083 32/111 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.