DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atf6 and YAP6

Sequence 1:NP_995745.1 Gene:Atf6 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_010545.3 Gene:YAP6 SGDID:S000002667 Length:383 Species:Saccharomyces cerevisiae

Alignment Length:391 Identity:87/392 (22%)
Similarity:143/392 (36%) Gaps:116/392 (30%)


  Fly    33 NSSAFYNDTSLDLSELIPDLQKEAFGLHFS---SNPITSEFSLSSPISGLKQIPSACSGEFKRNV 94
            :|.|.||.:..:|:|            |.|   :.|.||: .|...|:     |:..:|:...:|
Yeast    17 SSMATYNASEKNLNE------------HPSPQIAQPSTSQ-KLPYRIN-----PTTTNGDTDISV 63

  Fly    95 NDNNFQLDLTNSRNDLPEPNSSPTRSLNRSNVNGC------SNEE--------------AVYPLL 139
            |.|..|..|.|..: |..|  |..||:::|.::..      |||.              ::.|.:
Yeast    64 NSNPIQPPLPNLMH-LSGP--SDYRSMHQSPIHPSYIIPPHSNERKQSASYNRPQNAHVSIQPSV 125

  Fly   140 VDSDK-FDPFFEPAKVRSP------------NKEF-----NSTISNLSDIKNELP---ETSQDLG 183
            |...| :...:.|.::..|            |||:     .||:.:.:......|   :.|.|..
Yeast   126 VFPPKSYSISYAPYQINPPLPNGLPNQSISLNKEYIAEEQLSTLPSRNTSVTTAPPSFQNSADTA 190

  Fly   184 FNSYNTSRNNSTLTKSWPINTELNLDNQVPKTVLPLSRTIYLPSHDYKGLLPTVKCNGDRTLKKN 248
            .||.:.:.||..:||..|     :.|.|             |.|...|.|..|.:...:||.:|.
Yeast   191 KNSADNNDNNDNVTKPVP-----DKDTQ-------------LISSSGKTLRNTRRAAQNRTAQKA 237

  Fly   249 VNVRSK--ISNIVIKKKNATFIQSLKESTPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVS 311
            ...|.:  |.|  :::|:..|...|.|:....:::|.:......:|...|              :
Yeast   238 FRQRKEKYIKN--LEQKSKIFDDLLAENNNFKSLNDSLRNDNNILIAQHE--------------A 286

  Fly   312 LETRINKLEKECDSLKAENITLRDQIFLLATSCQRESGNANGLLHNYSGSERSENKNGRFTSKAK 376
            :...|..|..|.|.|..||..|:               |.|.::.|.....|:||:|.:..:|..
Yeast   287 IRNAITMLRSEYDVLCNENNMLK---------------NENSIIKNEHNMSRNENENLKLENKRF 336

  Fly   377 H 377
            |
Yeast   337 H 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 10/51 (20%)
coiled coil 287..338 CDD:269848 10/51 (20%)
YAP6NP_010545.3 bZIP_1 223..278 CDD:278595 12/57 (21%)
SMC_N <226..>373 CDD:330553 30/144 (21%)
coiled coil 226..280 CDD:269836 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001855
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.