DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atf6 and Creb3l4

Sequence 1:NP_995745.1 Gene:Atf6 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_006502373.3 Gene:Creb3l4 MGIID:1916603 Length:445 Species:Mus musculus

Alignment Length:505 Identity:105/506 (21%)
Similarity:184/506 (36%) Gaps:139/506 (27%)


  Fly     8 LYND--LSLLGEVTENNYDNNIVHDILNSSAFYNDTSLDLSELI---------------PDLQKE 55
            ||.:  |.|:..|.......|.|:..|.|..|.::||....:|:               |:|.:.
Mouse    22 LYPEMGLPLVKIVASKQTPGNPVYQSLLSQLFADETSSPQQDLLALRKLTERVNMELGCPELLEP 86

  Fly    56 AFGLHFSSNPITSEFSLSSPISGLKQIPSACSGEFKRNVNDNNFQLDLTNSRNDLPEPNSSPTRS 120
            ...: ||:.... |...:.|.|   ::| ...|..|...:|   .|:|....|.:....:||.|.
Mouse    87 PEDI-FSTGSFL-ELGFNGPAS---KVP-VTRGLQKSEPDD---FLNLFIDPNMIHCSETSPGRD 142

  Fly   121 LNRSNVNG-----CSNEEAVYPLLVDSDKFDPFFEPAKVRSPNKEFNSTISNLSDIKNELPETSQ 180
            ...|...|     .|:..|:|.::.||         ..::...:|...|...:|           
Mouse   143 SGVSEDPGSPAQQASSSPALYEVVYDS---------GTLQGTQREAGPTFGLIS----------- 187

  Fly   181 DLGFNSYNTSRNNSTLTKSWPINTELNLDNQVPKTVLPLSRTIY-LPSHDYKGLLPTVKCNGDRT 244
                                     :.:|...|..::|.:.|:. |||..::.:||.|   ..|.
Mouse   188 -------------------------IQIDQWTPALMVPDACTVSGLPSDSHRHILPRV---STRA 224

  Fly   245 LKKNVNVRSKISNIVIKKKNATFIQSLKESTPSH----TMDDKIYKKYQRMIKNRESASLSRKKR 305
            ......:.|...::.:..:....:.....:.|||    ..:::|.||.:|.|:|::||..||:::
Mouse   225 PAPPAAMPSCQHHLFLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRK 289

  Fly   306 KEYVVSLETRI-------NKLEKECDSLKAENITLRDQIFLLATSCQRESGNANGLLHNYSGSER 363
            |||:..||:|:       .||:::...|:.:||.|.:|:..|.....:.|..|            
Mouse   290 KEYLDGLESRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKLTAQTSSRA------------ 342

  Fly   364 SENKNGRFTSKAKHCNKNNTTATIKKNVAILFAMAFVVSLNAGNFQKYLNIPNNLEGKSEIEPVG 428
                           .:.:|...|     :||::|.::..:...||          |:||..|..
Mouse   343 ---------------AQTSTCVLI-----LLFSLALIILPSFSPFQ----------GQSEARPED 377

  Fly   429 KQL-SMSNRRLLWADSEEEYKEKNNLSTFLSGKQKE-PSLYFLNSGIRNH 476
            .|| .:.:|.:|..::..|..|    |..|..|.:| |.....|...:.|
Mouse   378 YQLHGVISRNILTHENVTENLE----SPVLKSKLEELPEAPTTNGSTKTH 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/58 (36%)
coiled coil 287..338 CDD:269848 21/58 (36%)
Creb3l4XP_006502373.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112574692
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.