DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atf6 and Atf6

Sequence 1:NP_995745.1 Gene:Atf6 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001074773.1 Gene:Atf6 MGIID:1926157 Length:656 Species:Mus musculus

Alignment Length:775 Identity:180/776 (23%)
Similarity:292/776 (38%) Gaps:220/776 (28%)


  Fly     5 EYNLYNDLSLLGEVTENNYDNNIVHDILNSSAFYNDTSLDLSELIPDLQKEAFGLHFSS------ 63
            |..|:.:|....:..:.::|  ..|:...::..:.:..|||.....||...  |.||.|      
Mouse    18 ESTLFAELGYFTDTDDVHFD--AAHEAYENNFDHLNFDLDLMPWESDLWSP--GSHFCSDMKAEP 78

  Fly    64 ---NPITSEFSLSSPISGLKQIPSACSGEFKRNVNDNNFQLDLTNSRNDLPEPNSSPTRSLNRSN 125
               :|.:|..|:|||.|     ..:||.  .::|.:   :|||.:|       :.||......| 
Mouse    79 QPLSPASSSCSISSPRS-----TDSCSS--TQHVPE---ELDLLSS-------SQSPLSLYGDS- 125

  Fly   126 VNGCSNEEAVYPL----------------LVDSDKFD----------PFFEPAKVRSPNKEFNST 164
               |::..:|.||                |....|..          |...||   :|..:.|::
Mouse   126 ---CNSPSSVEPLKEEKPVTGPGNKTEHGLTPKKKIQMSSKPSVQPKPLLLPA---APKTQTNAS 184

  Fly   165 ISNLSDIKNELPE----TSQDLGFNSYNTSRNNSTLTKSWPINTELNLDNQVPKTVLPLSRTI-- 223
            :...:.|...||.    ..|....:.........|:..|.|...:|    |.| .||..::.:  
Mouse   185 VPAKAIIIQTLPALMPLAKQQSIISIQPAPTKGQTVLLSQPTVVQL----QSP-AVLSSAQPVLA 244

  Fly   224 ------YLPSHDYKGL-LPTVK--CNGDRTLKKNVNVRSKISNIVIKKKNATFIQSLKESTPSHT 279
                  .||:|....| .|.|.  .||..::.|.|                     |:.:|.|..
Mouse   245 VTGGAAQLPNHVVNVLPAPVVSSPVNGKLSVTKPV---------------------LQSATRSMG 288

  Fly   280 MDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRDQIFLLATSC 344
            .|..:.::.||||||||||..||||:|||::.||.|:.....|.:.||.||.:|:.|:..:.   
Mouse   289 SDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGSLKRQLDEVV--- 350

  Fly   345 QRESGNANGLLHNYSGSERSENKNGRFTSKAKHCNKNNTTATIKKNVAILFAMAFVVSLNAGNFQ 409
                               |||:..:..|..            ::.|.::..:||:: ||.|.. 
Mouse   351 -------------------SENQRLKVPSPK------------RRAVCVMIVLAFIM-LNYGPM- 382

  Fly   410 KYLNIPNNLEGKS-EIEPVGKQLSMSN-RRLLWADSEEEYKEKNNLSTFLSGKQKEPSLYFLNSG 472
                  :.||.:| .::|   .:|.:| ||.|...|.:|.|:.::     ...||:...|     
Mouse   383 ------SMLEQESRRVKP---SVSPANQRRHLLEFSAKEVKDTSD-----GDNQKDSYSY----- 428

  Fly   473 IRNHKINSFENITKNVSHTYSYNEPPPLTYL-----------STRNCINRCRSHNGSSNQSKYFM 526
              :|.:::.:.:.........|..|||...|           ..|..::|   |.....:|:...
Mouse   429 --DHSVSNDKALMVLSEEPLLYMPPPPCQPLINTTESLRLNHELRGWVHR---HEVERTKSRRMT 488

  Fly   527 LAQNLHKWISGTLNVSNFSKEKEDSNGFEFFNNYFEEKRDIHIKHEKRKMFIDLNDYTSVLPEKQ 591
            .:|...:.:.|.|        ::.||                    .:.|.:...:.||:.....
Mouse   489 NSQQKARILQGAL--------EQGSN--------------------SQLMAVQYTETTSISRNSG 525

  Fly   592 QKLN----NTKSFENMREQINVISKIERRDDTFYVFSFNMDHALLPALSYNSSYRPKLSLVLPLE 652
            .:|.    :..|::..      ...|.||.|||||.||..||.||||.::|.:.|||:|:|||..
Mouse   526 SELQVYYASPGSYQGF------FDAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAI 584

  Fly   653 NPG---INGK--MKMIQVDCEVFNTKDFEVSHHLFPAKLRQNVIPRKPNKLNIKKSSTET 707
            |..   |||:  ..|:|:||:|.:|:...:.....|..||.:...:.........::|||
Mouse   585 NINDNVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTET 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 27/51 (53%)
coiled coil 287..338 CDD:269848 27/51 (53%)
Atf6NP_001074773.1 Transcription activation. {ECO:0000250} 1..137 30/128 (23%)
Ribophorin_II <223..>298 CDD:283474 18/86 (21%)
Basic motif 295..326 18/31 (58%)
bZIP_ATF6 296..347 CDD:269848 26/51 (51%)
coiled coil 296..347 CDD:269848 26/51 (51%)
Leucine-zipper 335..342 3/7 (43%)
Interaction with THBS4. {ECO:0000269|PubMed:22682248} 455..575 21/131 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112481025
eggNOG 1 0.900 E1_KOG4343
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4996
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001855
OrthoInspector 1 1.000 T616220
orthoMCL 1 0.900 OOG5_134659
Panther 1 1.100 O PTHR46164
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3813
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.